EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees
(View summary and phylogenies for PF00143 - Interferon)
FAM  PF00143
PID  Interferon
DES  Interferon alpha/beta domain
IPR  IPR000471
ANO  17
ALN  193
AID  0.440124
APH  ((((((((((INA1_BOVIN/1-187:0.29963,INA_FELCA/1-192:0.34178):0.05180,INA1_HORSE/1-184:0.10759):0.06498,(INA1_HUMAN/1-187:0.12341,INA4_HUMAN/1-187:0.09978):0.04166):0.08074,(INA1_MOUSE/1-187:0.07311,INA4_MOUSE/1-183:0.14226):0.26679):0.23101,INO1_HUMAN/1-187:0.22524):0.07194,(INT1_BOVIN/1-187:0.19283,IND1_HUMAN/1-187:0.11029):0.14322):0.04085,(INO1_HORSE/1-187:0.25781,INO2_HORSE/1-187:0.14016):0.04813):0.50895,INF1_CHICK/9-193:1.33108):0.53284,(INB1_BOVIN/1-186:0.40847,INB_HORSE/1-186:0.24076):0.05659):0.06575,INB_HUMAN/1-187:0.18112,INB_MOUSE/1-182:0.56510);
ATP  ((((((((((INA1_BOVIN/1-187,INA_FELCA/1-192),INA1_HORSE/1-184),(INA1_HUMAN/1-187,INA4_HUMAN/1-187)),(INA1_MOUSE/1-187,INA4_MOUSE/1-183)),INO1_HUMAN/1-187),(INT1_BOVIN/1-187,IND1_HUMAN/1-187)),(INO1_HORSE/1-187,INO2_HORSE/1-187)),INF1_CHICK/9-193),(INB1_BOVIN/1-186,INB_HORSE/1-186)),INB_HUMAN/1-187,INB_MOUSE/1-182);
ATL  7.02468
DNO  17
DLN  579
DID  0.59007
DPH  (((((((INA1_HORSE/1-184:0.06832,INA1_BOVIN/1-187:0.15686):0.01054,INA_FELCA/1-192:0.21187):0.01865,(INA4_HUMAN/1-187:0.06318,(INA1_HUMAN/1-187:0.05420,(INA1_MOUSE/1-187:0.04444,INA4_MOUSE/1-183:0.08518):0.19087):0.01542):0.02597):0.10224,(INO1_HUMAN/1-187:0.13498,((INT1_BOVIN/1-187:0.10252,IND1_HUMAN/1-187:0.04710):0.09294,(INO1_HORSE/1-187:0.15853,INO2_HORSE/1-187:0.07015):0.03269):0.02455):0.06958):0.33661,INF1_CHICK/9-193:0.84112):0.29727,(INB1_BOVIN/1-186:0.21329,INB_HORSE/1-186:0.10836):0.01980):0.06580,INB_HUMAN/1-187:0.09859,INB_MOUSE/1-182:0.33283);
DTP  (((((((INA1_HORSE/1-184,INA1_BOVIN/1-187),INA_FELCA/1-192),(INA4_HUMAN/1-187,(INA1_HUMAN/1-187,(INA1_MOUSE/1-187,INA4_MOUSE/1-183)))),(INO1_HUMAN/1-187,((INT1_BOVIN/1-187,IND1_HUMAN/1-187),(INO1_HORSE/1-187,INO2_HORSE/1-187)))),INF1_CHICK/9-193),(INB1_BOVIN/1-186,INB_HORSE/1-186)),INB_HUMAN/1-187,INB_MOUSE/1-182);
DTL  4.09445
RID  0.440124
RPH  ((((((((((INA1_BOVIN/1-187:0.29963,INA_FELCA/1-192:0.34178):0.05180,INA1_HORSE/1-184:0.10759):0.06498,(INA1_HUMAN/1-187:0.12341,INA4_HUMAN/1-187:0.09978):0.04166):0.08074,(INA1_MOUSE/1-187:0.07311,INA4_MOUSE/1-183:0.14226):0.26679):0.23101,INO1_HUMAN/1-187:0.22524):0.07194,(INT1_BOVIN/1-187:0.19283,IND1_HUMAN/1-187:0.11029):0.14322):0.04085,(INO1_HORSE/1-187:0.25781,INO2_HORSE/1-187:0.14016):0.04813):0.50895,INF1_CHICK/9-193:1.33108):0.53284,(INB1_BOVIN/1-186:0.40847,INB_HORSE/1-186:0.24076):0.05659):0.06575,INB_HUMAN/1-187:0.18112,INB_MOUSE/1-182:0.56510);
RTP  ((((((((((INA1_BOVIN/1-187,INA_FELCA/1-192),INA1_HORSE/1-184),(INA1_HUMAN/1-187,INA4_HUMAN/1-187)),(INA1_MOUSE/1-187,INA4_MOUSE/1-183)),INO1_HUMAN/1-187),(INT1_BOVIN/1-187,IND1_HUMAN/1-187)),(INO1_HORSE/1-187,INO2_HORSE/1-187)),INF1_CHICK/9-193),(INB1_BOVIN/1-186,INB_HORSE/1-186)),INB_HUMAN/1-187,INB_MOUSE/1-182);
RTL  7.02468
LNK  INA1_BOVIN/1-187:P07348:M11001
LNK  INA1_HORSE/1-184:P05003:M14540
LNK  INA1_HUMAN/1-187:P01562:J00210
LNK  INA1_MOUSE/1-187:P01572:X01974
LNK  INA4_HUMAN/1-187:P05014:X02955
LNK  INA4_MOUSE/1-183:P07351:X01973
LNK  INA_FELCA/1-192:P35849:S62636
LNK  INB1_BOVIN/1-186:P01578:M15477
LNK  INB_HORSE/1-186:P05012:M14546
LNK  INB_HUMAN/1-187:P01574:V00534
LNK  INB_MOUSE/1-182:P01575:K00020
LNK  IND1_HUMAN/1-187:P37290:L25664
LNK  INF1_CHICK/9-193:P42165:U07868
LNK  INO1_HORSE/1-187:P05001:M14544
LNK  INO1_HUMAN/1-187:P05000:X58822
LNK  INO2_HORSE/1-187:P05002:M14545
LNK  INT1_BOVIN/1-187:P15696:M60913
AMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxx
DMK  xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.........xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx...xxxxxxxxxxxxxxxxxxxxxxxxxxx
NAM  INO2_HORSE/1-187
ASQ  MALLPSLLTALVVYE-LWPCGALGCDLPQNHILVSRKNFVLLGQMSRISSAICLKDRKDFRFPQDMADGRQFPEAQAASVLHEMLQQIFSLFHTERSS.AAWNTTLLDELCTGLLRQLEDLDTCLEQEMGEEESALGTVRPT...LAVKRYFRGIHLYLKEKKYSDCAWEIVRMEIMRSFSSS.ANLQGRLRM
DSQ  ATGGCCCTCCTGCCCTCTCTCTTGACGGCCCTGGTGGTGTACGAG---TTATGGCCCTGTGGAGCTCTGGGCTGTGACCTGCCTCAGAACCACATCCTGGTTAGCAGGAAGAACTTCGTGCTTCTGGGCCAAATGAGCAGAATCTCCTCCGCAATCTGTCTGAAGGACAGAAAAGACTTCAGGTTCCCCCAGGACATGGCGGATGGCAGGCAGTTCCCAGAGGCCCAGGCCGCGTCTGTCCTCCACGAGATGCTCCAGCAGATCTTCAGCCTCTTCCACACAGAGCGCTCGTCT...GCTGCCTGGAACACGACCCTCCTGGACGAACTCTGCACGGGACTCCTTCGGCAGCTGGAAGACCTGGACACCTGTTTGGAGCAGGAGATGGGAGAGGAAGAATCTGCCCTGGGAACTGTGCGCCCTACA.........CTGGCCGTGAAGAGGTACTTCCGGGGGATCCATCTCTACCTGAAAGAGAAGAAATACAGTGACTGTGCCTGGGAGATTGTCCGAATGGAAATCATGAGATCCTTCTCTTCATCA...GCAAACCTGCAAGGAAGGTTAAGAATG
TRN  10010101100011000
NAM  INO1_HORSE/1-187
ASQ  MAFSVSSLMALVVIS-SSPVSSMSCDLPASLDLRKQETLRVLHQMETISPPSCLKHRTDFRFPQEQLDGRQFPEAQATSVLQEMLQQIVSLFHTERSS.AAWNTTLLDRLLAGLHQQLEDLNTCLDEQTGEEESALGTVGPT...LAVKRYFRRIRLYLTEKKYSDCAWEIVRVDIMRSFSSS.ANLQGRLGM
DSQ  ATGGCTTTCTCAGTGTCTTCCCTGATGGCACTGGTGGTGATCTCC---TCCAGCCCCGTCTCCTCCATGAGCTGCGACCTGCCTGCGAGCCTTGACTTGAGAAAGCAGGAGACCCTCAGAGTTCTGCACCAGATGGAGACAATCTCTCCTCCTTCCTGTCTGAAGCACAGGACAGACTTCAGGTTCCCCCAGGAGCAGCTGGATGGCAGGCAGTTCCCAGAGGCCCAGGCCACGTCTGTCCTCCAGGAGATGCTCCAGCAGATCGTCAGCCTCTTCCACACAGAGCGCTCGTCT...GCTGCCTGGAACACGACTCTGCTGGACCGACTCCTCGCGGGACTCCATCAGCAGCTGGAAGACCTCAACACCTGCTTGGATGAGCAGACAGGAGAGGAAGAATCCGCCCTGGGAACTGTGGGCCCTACA.........CTGGCCGTGAAGAGGTACTTCAGGAGAATCCGTCTGTACCTGACAGAGAAGAAATACAGTGACTGTGCCTGGGAGATTGTCAGAGTGGACATCATGAGATCCTTCTCTTCATCA...GCAAACCTGCAAGGAAGGTTAGGAATG
TRN  10010101100011000
NAM  INO1_HUMAN/1-187
ASQ  MALLFPLLAALVMTS-YSPVGSLGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSS.AAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPA...LTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLS.TNMQERLRS
DSQ  ATGGCCCTCCTGTTCCCTCTACTGGCAGCCCTAGTGATGACCAGC---TATAGCCCTGTTGGATCTCTGGGCTGTGATCTGCCTCAGAACCATGGCCTACTTAGCAGGAACACCTTGGTGCTTCTGCACCAAATGAGGAGAATCTCCCCTTTCTTGTGTCTCAAGGACAGAAGAGACTTCAGGTTCCCCCAGGAGATGGTAAAAGGGAGCCAGTTGCAGAAGGCCCATGTCATGTCTGTCCTCCATGAGATGCTGCAGCAGATCTTCAGCCTCTTCCACACAGAGCGCTCCTCT...GCTGCCTGGAACATGACCCTCCTAGACCAACTCCACACTGGACTTCATCAGCAACTGCAACACCTGGAGACCTGCTTGCTGCAGGTAGTGGGAGAAGGAGAATCTGCTGGGGCAATTAGCAGCCCTGCA.........CTGACCTTGAGGAGGTACTTCCAGGGAATCCGTGTCTACCTGAAAGAGAAGAAATACAGCGACTGTGCCTGGGAAGTTGTCAGAATGGAAATCATGAAATCCTTGTTCTTATCA...ACAAACATGCAAGAAAGACTGAGAAGT
TRN  10010101100011000
NAM  IND1_HUMAN/1-187
ASQ  MAFVLSLLMALVLVS-YGPGGSLGCDLSQNHVLVGRKNLRLLDEMRRLSPHFCLQDRKDFALPQEMVEGGQLQEAQAISVLHEMLQQSFNLFHTEHSS.AAWDTTLLEPCRTGLHQQLDNLDACLGQVMGEEDSALGRTGPT...LALKRYFQGIHVYLKEKGYSDCAWETVRLEIMRSFSSL.ISLQERLRM
DSQ  ATGGCCTTCGTGCTCTCTCTACTCATGGCCCTGGTGCTGGTCAGC---TACGGCCCAGGAGGATCCCTGGGTTGTGACCTGTCTCAGAACCACGTGCTGGTTGGCAGGAAGAACCTCAGGCTCCTGGACGAAATGAGGAGACTCTCCCCTCACTTTTGTCTGCAGGACAGAAAAGACTTCGCTTTACCCCAGGAAATGGTGGAGGGCGGCCAGCTCCAGGAGGCCCAGGCCATCTCTGTGCTCCATGAGATGCTCCAGCAGAGCTTCAACCTCTTCCACACAGAGCACTCCTCT...GCTGCCTGGGACACCACCCTCCTGGAGCCATGCCGCACTGGACTCCATCAGCAGCTGGACAACCTGGATGCCTGCCTGGGGCAGGTGATGGGAGAGGAAGACTCTGCCCTGGGAAGGACGGGCCCCACC.........CTGGCTCTGAAGAGGTACTTCCAGGGCATCCATGTCTACCTGAAAGAGAAGGGATACAGCGACTGCGCCTGGGAAACCGTCAGACTGGAAATCATGAGATCCTTCTCTTCATTA...ATCAGCTTGCAAGAAAGGTTAAGAATG
TRN  10010101100011000
NAM  INT1_BOVIN/1-187
ASQ  MAFVLSLLMALVLVS-YGPGRSLGCYLSEDHMLGARENLRLLARMNRLSPHPCLQDRKDFGLPQEMVEGNQLQKDQAISVLHEMLQQCFNLFYTEHSS.AAWNTTLLEQLCTGLQQQLEDLDACLGPVMGEKDSDMGRMGPI...LTVKKYFQGIHVYLKEKEYSDCAWEIIRVEMMRALSSS.TTLQKRLRK
DSQ  ATGGCCTTCGTGCTCTCTCTACTGATGGCCCTGGTGCTGGTCAGC---TACGGCCCGGGACGATCTCTGGGTTGTTACCTGTCTGAGGACCACATGCTAGGTGCCAGGGAGAACCTCAGGCTCCTGGCCCGAATGAACAGACTCTCTCCTCATCCCTGTCTGCAGGACAGAAAAGACTTTGGTCTTCCTCAGGAGATGGTGGAGGGCAACCAGCTCCAGAAGGATCAGGCTATCTCTGTGCTCCATGAGATGCTCCAGCAGTGCTTCAACCTCTTCTACACAGAGCACTCGTCT...GCTGCCTGGAACACCACCCTCCTGGAGCAGCTCTGCACTGGGCTCCAACAGCAGCTGGAGGACCTGGACGCCTGCCTGGGCCCAGTGATGGGAGAGAAAGACTCTGACATGGGAAGGATGGGCCCCATT.........CTGACTGTGAAGAAGTACTTCCAGGGCATCCATGTCTACCTGAAAGAAAAAGAATACAGTGACTGCGCCTGGGAAATCATCAGAGTGGAGATGATGAGAGCCCTCTCTTCATCA...ACCACCTTGCAAAAAAGGTTAAGAAAG
TRN  10010101100011000
NAM  INA_FELCA/1-192
ASQ  MALPSSFLVALVALG-CNSVCSLGCDLPQTHGLLNRRALTLLGQMRRLPASSCQKDRNDFAFPQDVFGGDQSHKAQALSVVHVTNQKIFHFFCTEASSsAAWNTTLLEEFCTGLDRQLTRLEACVLQEVEEGEAPLTNEDIHpedSILRNYFQRLSLYLQEKKYSPCAWEIVRAEIMRSLYYSsTALQKRLRS
DSQ  ATGGCGCTGCCCTCTTCCTTCTTGGTGGCCCTGGTGGCGCTGGGC---TGCAACTCCGTCTGCGTGCTGGGCTGTGACCTGCCTCAGACCCACGGCCTGCTGAACAGGAGGGCCTTGACGCTCCTGGGACAAATGAGGAGACTCCCTGCCAGCTCCTGTCAGAAGGACAGAAATGACTTCGCCTTCCCCCAGGACGTGTTCGGTGGAGACCAGTCCCACAAGGCCCAAGCCCTCTCGGTGGTGCACGTGACGAACCAGAAGATCTTCCACTTCTTCTGCACAGAGGCGTCCTCGtctGCTGCTTGGAACACCACCCTCCTGGAGGAATTTTGCACGGGACTTGATCGGCAGCTGACCCGCCTGGAAGCCTGTGTCCTGCAGGAGGTGGAGGAGGGAGAGGCTCCCCTGACGAACGAGGACATTCATcccgaggacTCCATCCTGAGGAACTACTTCCAAAGACTCTCCCTCTACCTGCAAGAGAAGAAATACAGCCCTTGTGCCTGGGAGATCGTCAGAGCAGAAATCATGAGATCCTTGTATTATTCAtcaACAGCCTTGCAGAAAAGATTAAGGAGC
TRN  10010101100011000
NAM  INA4_HUMAN/1-187
ASQ  MALSFSLLMAVLVLS-YKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRHDFGFPEEEFDGHQFQKTQAISVLHEMIQQTFNLFSTEDSS.AAWEQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNVDSI...LAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFS.TNLQKRLRR
DSQ  ATGGCCCTGTCCTTTTCTTTACTGATGGCCGTGCTGGTGCTCAGC---TACAAATCCATCTGTTCTCTGGGCTGTGATCTGCCTCAGACCCACAGCCTGGGTAATAGGAGGGCCTTGATACTCCTGGCACAAATGGGAAGAATCTCTCATTTCTCCTGCCTGAAGGACAGACATGATTTCGGATTCCCCGAGGAGGAGTTTGATGGCCACCAGTTCCAGAAGACTCAAGCCATCTCTGTCCTCCATGAGATGATCCAGCAGACCTTCAATCTCTTCAGCACAGAGGACTCATCT...GCTGCTTGGGAACAGAGCCTCCTAGAAAAATTTTCCACTGAACTTTACCAGCAACTGAATGACCTGGAAGCATGTGTGATACAGGAGGTTGGGGTGGAAGAGACTCCCCTGATGAATGTGGACTCCATC.........CTGGCTGTGAGGAAATACTTCCAAAGAATCACTCTTTATCTAACAGAGAAGAAATACAGCCCTTGTGCCTGGGAGGTTGTCAGAGCAGAAATCATGAGATCCCTCTCGTTTTCA...ACAAACTTGCAAAAAAGATTAAGGAGG
TRN  10010101100011000
NAM  INA1_HUMAN/1-187
ASQ  MASPFALLMVLVVLS-CKSSCSLGCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSS.AAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSI...LAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLS.TNLQERLRR
DSQ  ATGGCCTCGCCCTTTGCTTTACTGATGGTCCTGGTGGTGCTCAGC---TGCAAGTCAAGCTGCTCTCTGGGCTGTGATCTCCCTGAGACCCACAGCCTGGATAACAGGAGGACCTTGATGCTCCTGGCACAAATGAGCAGAATCTCTCCTTCCTCCTGTCTGATGGACAGACATGACTTTGGATTTCCCCAGGAGGAGTTTGATGGCAACCAGTTCCAGAAGGCTCCAGCCATCTCTGTCCTCCATGAGCTGATCCAGCAGATCTTCAACCTCTTTACCACAAAAGATTCATCT...GCTGCTTGGGATGAGGACCTCCTAGACAAATTCTGCACCGAACTCTACCAGCAGCTGAATGACTTGGAAGCCTGTGTGATGCAGGAGGAGAGGGTGGGAGAAACTCCCCTGATGAATGCGGACTCCATC.........TTGGCTGTGAAGAAATACTTCCGAAGAATCACTCTCTATCTGACAGAGAAGAAATACAGCCCTTGTGCCTGGGAGGTTGTCAGAGCAGAAATCATGAGATCCCTCTCTTTATCA...ACAAACTTGCAAGAAAGATTAAGGAGG
TRN  10010101100011000
NAM  INA1_HORSE/1-184
ASQ  MALPVSLLMALVVLS-CHSICSLGCDLPHTHSLGNTRVLMLLGQMRRISPFSCLKDRNDFGFPQEVFDGNQFRKPQAISAVHETIQQIFHLFSTDGSS.AAWDESLLDKLYTGLYQQLTELEACLSQEVGVEETPLMNEDSL...LAVRRYFQRIALYLQEKKYSPCAWEIVRAEIMRSFSSS.TNLPQS---
DSQ  ATGGCTCTGCCTGTTTCCTTACTGATGGCCCTGGTGGTGCTCAGC---TGCCACTCCATCTGCTCTCTGGGATGTGACCTGCCTCACACCCATAGCCTGGGCAACACAAGGGTCTTGATGCTCCTGGGGCAAATGAGGAGAATCTCCCCCTTCTCCTGCCTGAAGGACAGAAATGACTTTGGATTCCCCCAGGAGGTGTTTGACGGCAACCAGTTCCGGAAGCCTCAAGCCATCTCTGCGGTCCATGAGACGATCCAACAGATCTTCCACCTCTTCAGCACAGACGGCTCGTCT...GCCGCCTGGGACGAGAGCCTCCTAGACAAACTCTACACTGGACTCTATCAGCAGCTGACTGAGCTGGAAGCCTGTCTGAGCCAGGAGGTGGGGGTGGAAGAGACGCCCCTGATGAACGAGGACTCCCTG.........CTGGCTGTGAGGAGATACTTCCAAAGAATCGCTCTCTATCTGCAAGAGAAGAAATACAGCCCTTGTGCCTGGGAGATCGTCAGAGCAGAAATCATGAGATCCTTCTCTTCATCC...ACAAACTTGCCGCAGAGT---------
TRN  10010101100011000
NAM  INA1_BOVIN/1-187
ASQ  MAPAWSLLLALLLLS-CNAICSLGCHLPHSHSLAKRRVLTLLRQLRRVSPSSCLQDRNDFAFPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSA.AVWDESLLDRLRTALDQQLTDLQACLRQEEGLPGAPLLKEDSS...LAVRKYFHRLTLYLQEKRHSPCAWEVVRAQVMRAFSSS.TNLQERFRR
DSQ  ATGGCCCCAGCCTGGTCCCTCCTCCTGGCTCTGCTGCTGCTCAGC---TGCAACGCCATCTGCTCTCTGGGCTGCCACCTGCCTCACTCCCACAGCCTGGCCAAGAGGAGAGTCCTGACACTCCTGCGACAACTGAGGAGGGTCTCCCCTTCCTCCTGCCTGCAGGACAGAAATGACTTCGCATTCCCCCAGGAGGCGCTGGGTGGCAGCCAGTTGCAGAAGGCTCAAGCCATCTCTGTACTCCACGAGGTGACCCAACACACCTTCCAGCTTTTCAGCACAGAGGGCTCGGCC...GCTGTGTGGGATGAGAGCCTCCTGGACAGACTCCGCACTGCACTGGATCAGCAGCTCACTGACCTGCAAGCCTGTCTGAGGCAGGAGGAGGGGCTGCCAGGGGCTCCCCTGCTCAAGGAGGACTCCAGC.........CTGGCTGTGAGGAAATACTTCCACAGACTCACTCTCTATCTGCAAGAGAAGAGACACAGCCCTTGTGCCTGGGAGGTTGTCAGAGCACAAGTCATGAGAGCCTTCTCTTCCTCA...ACAAACTTGCAGGAGAGATTCAGGAGA
TRN  10010101100011001
NAM  INA4_MOUSE/1-183
ASQ  MARLCAFLMILVMMSYYWSACSLGCDLPHTYNLGNKRALTVLEEMRRLPPLSCLKDRKDFGFPLEKVDNQQIQKAQAILVLRDLTQQILNLFTSKDLS.ATWNATLLDSFCNDLHQQLNDLKACVMQ-----EPPLTQEDSL...LAVRTYFHRITVYLRKKKHSLCAWEVIRAEVWRALSSS.TNLLARLSE
DSQ  ATGGCTAGGCTCTGTGCTTTCCTCATGATCCTAGTAATGATGAGCTACTACTGGTCAGCCTGTTCTCTAGGATGTGACCTGCCTCACACTTATAACCTCGGGAACAAGAGGGCCTTGACAGTCCTGGAAGAAATGAGAAGACTCCCCCCTCTTTCCTGCCTGAAGGACAGGAAGGATTTTGGATTCCCCTTGGAGAAGGTGGATAACCAACAGATCCAGAAGGCTCAAGCCATCCTTGTGCTAAGAGATCTTACCCAGCAGATTTTGAACCTCTTCACATCAAAAGACTTGTCT...GCTACTTGGAATGCAACTCTCCTAGACTCATTCTGCAATGACCTCCATCAGCAGCTCAATGATCTCAAAGCCTGTGTGATGCAG---------------GAACCTCCTCTGACCCAGGAAGACTCCCTG.........CTGGCTGTGAGGACATACTTCCACAGGATCACTGTGTACCTGAGAAAGAAGAAACACAGCCTCTGTGCCTGGGAGGTGATCAGAGCAGAAGTCTGGAGAGCCCTCTCTTCCTCA...ACCAACTTGCTGGCAAGACTGAGTGAG
TRN  10010101100011001
NAM  INA1_MOUSE/1-187
ASQ  MARLCAFLMVLAVMS-YWPTCSLGCDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSS.AAWNATLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDAL...LAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSS.ANVLGRLRE
DSQ  ATGGCTAGGCTCTGTGCTTTCCTGATGGTCCTGGCGGTGATGAGC---TACTGGCCAACCTGCTCTCTAGGATGTGACCTGCCTCAGACTCATAACCTCAGGAACAAGAGAGCCTTGACACTCCTGGTACAAATGAGGAGACTCTCCCCTCTCTCCTGCCTGAAGGACAGGAAGGACTTTGGATTCCCGCAGGAGAAGGTGGATGCCCAGCAGATCAAGAAGGCTCAAGCCATCCCTGTCCTGAGTGAGCTGACCCAGCAGATCCTGAACATCTTCACATCAAAGGACTCATCT...GCTGCTTGGAATGCAACCCTCCTAGACTCATTCTGCAATGACCTCCACCAGCAGCTCAATGACCTGCAAGGTTGTCTGATGCAGCAGGTGGGGGTGCAGGAATTTCCCCTGACCCAGGAAGATGCCCTG.........CTGGCTGTGAGGAAATACTTCCACAGGATCACTGTGTACCTGAGAGAGAAGAAACACAGCCCCTGTGCCTGGGAGGTGGTCAGAGCAGAAGTCTGGAGAGCCCTGTCTTCCTCT...GCCAATGTGCTGGGAAGACTGAGAGAA
TRN  10010101100011001
NAM  INB_MOUSE/1-182
ASQ  MNNRWILHAAFLLCFSTTALSINYKQLQLQERTNIRKCQELLEQLNGKIN---LTYRADFKIPMEMT--EKMQKSYTAFAIQEMLQNVFLVFRNNFSS.TGWNETIVVRLLDELHQQTVFLKTVLEEKQE-ERLTWEMSSTA...LHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLII.RRLTRNFQN
DSQ  ATGAACAACAGGTGGATCCTCCACGCTGCGTTCCTGCTGTGCTTCTCCACCACAGCCCTCTCCATCAACTATAAGCAGCTCCAGCTCCAAGAAAGGACGAACATTCGGAAATGTCAGGAGCTCCTGGAGCAGCTGAATGGAAAGATCAAC---------CTCACCTACAGGGCGGACTTCAAGATCCCTATGGAGATGACG------GAGAAGATGCAGAAGAGTTACACTGCCTTTGCCATCCAAGAGATGCTCCAGAATGTCTTTCTTGTCTTCAGAAACAATTTCTCCAGC...ACTGGGTGGAATGAGACTATTGTTGTACGTCTCCTGGATGAACTCCACCAGCAGACAGTGTTTCTGAAGACAGTACTAGAGGAAAAGCAAGAG---GAAAGATTGACGTGGGAGATGTCCTCAACTGCT.........CTCCACTTGAAGAGCTATTACTGGAGGGTGCAAAGGTACCTTAAACTCATGAAGTACAACAGCTACGCCTGGATGGTGGTCCGAGCAGAGATCTTCAGGAACTTTCTCATCATT...CGAAGACTTACCAGAAACTTCCAAAAC
TRN  10010101100011001
NAM  INB_HUMAN/1-187
ASQ  MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEY-CLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSS.TGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSS...LHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFI.NRLTGYLRN
DSQ  ATGACCAACAAGTGTCTCCTCCAAATTGCTCTCCTGTTGTGCTTCTCCACTACAGCTCTTTCCATGAGCTACAACTTGCTTGGATTCCTACAAAGAAGCAGCAATTTTCAGTGTCAGAAGCTCCTGTGGCAATTGAATGGGAGGCTTGAATAC---TGCCTCAAGGACAGGATGAACTTTGACATCCCTGAGGAGATTAAGCAGCTGCAGCAGTTCCAGAAGGAGGACGCCGCATTGACCATCTATGAGATGCTCCAGAACATCTTTGCTATTTTCAGACAAGATTCATCTAGC...ACTGGCTGGAATGAGACTATTGTTGAGAACCTCCTGGCTAATGTCTATCATCAGATAAACCATCTGAAGACAGTCCTGGAAGAAAAACTGGAGAAAGAAGATTTCACCAGGGGAAAACTCATGAGCAGT.........CTGCACCTGAAAAGATATTATGGGAGGATTCTGCATTACCTGAAGGCCAAGGAGTACAGTCACTGTGCCTGGACCATAGTCAGAGTGGAAATCCTAAGGAACTTTTACTTCATT...AACAGACTTACAGGTTACCTCCGAAAC
TRN  10010101100011001
NAM  INB_HORSE/1-186
ASQ  MTYRWILPMALLLCFSTTALSVNYDLLRSQLRSSNSACLMLLRQLNGAPQR-CPEDTMNFQVPEEIEQAQQFQKEDAALVIYEMLQHTWRIFRRNFAS.TGWNETIVKNLLVEVHLQMDRLETNLEEIME-EESSTWGNTTI...LRLKKYYGRISQYLKAKKYSHCAWTVVQAEMLRNLAFL.NGLTDYLQN
DSQ  ATGACCTACAGGTGGATCCTCCCAATGGCCCTCCTGCTGTGTTTCTCCACCACGGCTCTTTCTGTGAACTATGACTTGCTTCGGTCCCAACTAAGAAGCAGCAATTCAGCATGTCTGATGCTCCTGCGGCAGTTGAATGGAGCCCCTCAACGT---TGCCCCGAGGACACAATGAACTTCCAGGTCCCTGAGGAGATTGAGCAAGCACAGCAGTTCCAGAAGGAGGATGCTGCATTGGTCATCTATGAGATGCTCCAGCACACCTGGCGTATTTTCAGAAGAAATTTCGCTAGC...ACTGGCTGGAATGAGACCATCGTTAAGAACCTCCTTGTGGAAGTCCATCTGCAGATGGACCGTCTGGAGACAAACCTGGAGGAAATAATGGAG---GAGGAAAGCTCCACCTGGGGAAACACAACCATT.........CTGCGCCTGAAGAAATACTACGGAAGGATCTCGCAGTACCTGAAGGCCAAGAAGTACAGCCACTGTGCCTGGACAGTGGTCCAAGCGGAAATGCTCAGGAACTTGGCCTTCCTT...AACGGACTCACAGATTACCTCCAAAAC
TRN  10010101100011001
NAM  INB1_BOVIN/1-186
ASQ  MTYRCLLQMVLLLCFSTTALSRSYSLLRFQQRQSLKECQKLLGQLPSTSQH-CLEARMDFQMPEEMKQEQQFQKEDAILVMYEVLQHIFGILTRDFSS.TGWSETIIEDLLKELYWQMNRLQPIQKEIMQ-KQNSTTEDTIV...PHLGKYYFNLMQYLESKEYDRCAWTVVQVQILTNVSFL.MRLTGYVRD
DSQ  ATGACCTACCGGTGCCTCCTCCAGATGGTTCTCCTGCTGTGTTTCTCCACCACAGCTCTTTCCAGGAGCTACAGCTTGCTTCGATTCCAACAACGTCAGAGCCTTAAAGAGTGTCAGAAACTCCTGGGGCAGTTACCTTCAACTTCTCAACAT---TGCCTCGAGGCCAGGATGGACTTCCAGATGCCTGAGGAGATGAAGCAAGAACAGCAGTTCCAGAAGGAAGATGCCATATTGGTCATGTATGAGGTGCTCCAGCACATCTTCGGCATTCTCACCAGAGACTTCTCCAGC...ACTGGCTGGTCTGAGACCATCATCGAGGACCTCCTTAAGGAACTCTATTGGCAGATGAATCGTCTGCAGCCAATCCAGAAGGAAATAATGCAG---AAGCAAAACTCCACTACGGAAGACACGATCGTT.........CCCCACCTAGGGAAATATTACTTCAACCTCATGCAGTACCTGGAGTCCAAGGAGTACGACAGGTGTGCCTGGACAGTCGTGCAAGTGCAAATACTCACGAACGTTTCTTTCCTG...ATGAGACTAACAGGTTACGTCCGTGAC
TRN  10010101100011000
NAM  INF1_CHICK/9-193
ASQ  HPRGYGILLLTLLLKALATTASACNHLRPQDATFSHDSLQLLRDMAPTLPQLCPQHNASCSFNDTILDTSNTR--QADKTTHDILQHLFKILSSPSTP.AHWNDSQRQSLLNRIHRYTQHLEQCLDSSDTRSRTRWPRNLHL...-TIKKHFSCLHTFLQDNDYSACAWEHVRLQARAWFLHI.HNLTGNTRT
DSQ  CACCCACGGGGGTACGGCATCCTGCTGCTCACGCTCCTTCTGAAAGCTCTCGCCACCACCGCCTCCGCCTGCAACCACCTTCGCCCCCAGGATGCCACCTTCTCTCACGACAGCCTCCAGCTCCTCCGGGACATGGCTCCCACACTACCCCAGCTGTGCCCACAGCACAACGCGTCTTGCTCCTTCAACGACACCATCCTGGACACCAGCAACACCCGG------CAAGCCGACAAAACCACCCACGACATCCTTCAGCACCTCTTCAAAATCCTCAGCAGCCCCAGCACTCCA...GCCCACTGGAACGACAGCCAACGCCAAAGCCTCCTCAACCGGATCCACCGCTACACCCAGCACCTCGAGCAATGCTTGGACAGCAGCGACACGCGCTCCCGGACGCGATGGCCTCGCAACCTTCACCTC.........---ACCATCAAAAAACACTTCAGCTGCCTCCACACCTTCCTCCAAGACAACGATTACAGCGCCTGCGCCTGGGAACACGTCCGCCTGCAAGCTCGTGCCTGGTTCCTGCACATC...CACAACCTCACAGGCAACACGCGCACT
TRN  11011101101011011
//