EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07857 alignment
(6 sequences with 277 aa)


Q9U3C0_CAEEL/17-268 GYVALLLSCCAFGTMFVPLRRRNCKDGFFVQWIECGVVFIVGCIFYAARGFPKFEPIACIGGFLYATGNVFSVPIVEGIGMGVGFLIWTSLQIIVGWGVARFGLFQWIAPQNVKNDVLNYIGIALTIVSGVLLIFVKHVETEPENEYDVTSKEMEHQEEIEQRLSNSERDSSFDMAGLAK------------KLPYILM-------AMVLACLHGLMMSPIEYLKQQNP------PTDSFQVFDYIFPFYTSVFLFSTLYFFAYCVILRRKAYVERN
Q95QA2_CAEEL/57-321 GILACLTATFTLGSVFAPIKRFPSSDGFMVQFFMSLGGFITSLAIHALLGFPPIYPLAMLGGALWCAANAFAFLIMNRLGLAVPILIWSTVSCLTGWATTRYGLFG-VPKGIPSSVILNYIGIIVLVVGSSFFLFIKSHVYIPKKRNNSESLTSGGEIPSKKS--MATQSSEED-----DIVQHPHHVSPIVRIVFFFEFYSTQKNYLILGLFYGSMCTPVTFIQNRPD----LYPGAPTEGLPYLFSFFCGIMPMSTFVLVIYSAVKKNNPSLPSY
Q7Z5S9_HUMAN/11-263 GYISCFVAILLFGSNFVPLKKFDTGDGMFLQWVLCAAIWLVALVVNLILHCPKFWPFAMLGGCIWATGNIAVVPIIKTIGLGLGILIWGSFNALTGWASSRFGWFG-LDAEEVSNPLLNYIGAGLSVVSAFIFLFIKSEIPNNTCSMDTTPLITEHVINTTQD-----PCSWVD-----KLSTVHH------RIVGCSL-------AVISGVLYGSTFVPIIYIKDHSKRNDSIYAGASQYDLDYVFAHFSGIFLTSTVYFLAYCIAMKNSPKLYPE
YRR6_CAEEL/336-594 GLSACALSSVLFGSMFVPVKKCHSGNGIFVQWIMSTAILLVGIVVYSTQGFPEFEPLAMLGGMFWALGNATAVPIMNTIGIGMGMLVWGTTNCVAGWAAGRFGLFG-INSTVPEYPFLNYFGLVLVVFGGFLFSQIR--PNEPQTASERSPLMVAPDDDLTDD--VAPDDSDIVVPRGGAVPTRAHRNQK--RLLAIIT-------SLVAGVFYGFTFVPVIYIQDHPE----IYPTAPKTGLGYVFSHYIGIFCTASALMIGYVIYSRNNPFASSR
O01810_CAEEL/6-270 GLAACAVSSVFFGSMFVPIKSYDSRDGIFAQWMMSIAILLVGFIVFATTGFPGFYPLAMLGGASWCIGNATAIPIISRLGLAVSILVWNTSNCLVGWAGGRFGLFG-MKAQVPASPFLNYLGLVFVVIGGSIFAQVRSEPLPIAKKTSRTSFDLENLNSEEKKALNTTESSDDGGLETEVLRPDKNLNSGTQRFFAFIT-------AIVAGFFYGMTFVPVIRMIDNPQ----LYPFYPQDGISYVFSHYFGIFITSTIIFVIYSIFRRNQPYAPPN
Q20583_CAEEL/8-246 GIVCAVVSAITFGSTYVPLKWFHKGDGLYFQWVQSLGQLLVGVAVAMTTAPAPIHPIAMLSGMFYSVGNSLTVFIMDGIGLAIGYLLWNTVTCVVGWAVTRFGLFA-NPQQYPKSDWLNILGVVTVCVGGAIYAPIKHIP----ARVRPAPWSLE-EDNYKDDPLVVKEVSCTR------------------RILCLFL-------TIFVGFLYGNFLTPINYIIANE-------PGSHQDVRAYILSYCLGSFVTSTVIFFVYSIVKKNVPLVNAE