EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF07068 alignment
(4 sequences with 502 aa)


Q9MCE3_BPR69/10-502 LVDKWKELLEGEG--LPEIAN-SKQAIIAKIFENQEKDFEVSPEYKDDKIAQAFGSFLTEAEIGGDHGY.AQNIAAGQTSGAVTQIGPAV.GMVRRAIPNLIAFDICGVQPMNSPTGQVFALRAVYGKDPIAAGAKEAFHPMYAPDAMFSGQGAA-KKFPALAASTQTKVGDIYT-HFFQETGTVY---LQASAQVTISSSADDAAKLDAEIIKQMEAGALVEIAEGMATSIAELQEGFNGSTDNPWNEMGFRIDKQVIEAKSRQLKAAYSIELAQDLRAVHGMDADAELSGILATEIMLEINREVVDWINYSAQVGKSGMSNIVGSKAGVFDFQDPIDIRGVRWAGESFKALLFQIDKEAVEIARQTGRGEGNFIIA.RNVVNVLASVDTGISYAAQGLASG-FPTDTTKSVFAGVLGGKYRVYIDQYAKQDYFTVGYKGANEMDAGIYYAPYVALTPLRGSDPKNFQPVMGFKTRYGIGVNPFAESSLQAPGARIQSGMP
COAT_BPT4/9-501 LLNKWKPLLEGEG--LPEIAN-SKQAIIAKIFENQEKDFQTAPEYKDEKIAQAFGSFLTEAEIGGDHGYnATNIAAGQTSGAVTQIGPAVmGMVRRAIPNLIAFDICGVQPMNSPTGQVFALRAVYGKDPVAAGAKEAFHPMYGPDAMFSGQGAA-KKFPALAASTQTTVGDIYT-HFFQETGTVY---LQASVQVTIDAGATDAAKLDAEIKKQMEAGALVEIAEGMATSIAELQEGFNGSTDNPWNEMGFRIDKQVIEAKSRQLKAAYSIELAQDLRAVHGMDADAELSGILATEIMLEINREVVDWINYSAQVGKSGMTLTPGSKAGVFDFQDPIDIRGARWAGESFKALLFQIDKEAVEIARQTGRGEGNFIIAsRNVVNVLASVDTGISYAAQGLATG-FSTDTTKSVFAGVLGGKYRVYIDQYAKQDYFTVGYKGPNEMDAGIYYAPYVALTPLRGSDPKNFQPVMGFKTRYGIGINPFAESAAQAPASRIQSGMP
Q38056_BPS14/10-502 LVDKWKELLEGEG--LPEIAN-SKQAIIAKIFENQEKDFEVSPEYKDEKIAQAFGSFLTEAEIGGDHGYnAQNIAAGQTSGAVTQIGRSVmGMVRRAIPNLIAFDICGVQPMNSPTGQVFALRAVYGKDPIAADAKEAFHPMYAPDAMFSGQGAA-KAFTPVTAGMATVAGDIYY-HFFAETGSTY---LQATKVVTISAEASTPELMDAEIIKQMEAGVLVEIAEGMATSIAELQEGFNGSTDNPWNEMGFRIDKQVIEAKSRQLKAAYSIELAQDLRAVHGMDADAELSGILATEIMLEINREVVDWINYSAQVGKSGMTNIVGSKAGVFDFQDPIDIRGARWAGESFKALLFQIDKEAVEIARQTGRGEGNFIIAsRNVVNVLASVDTGISYAAQGLASG-FNTDTTKSVFAGVLGGKYRVYIDQYAKQDYFTVGYKGANEMDAGIYYAPYVALXPLRGSDPKNFQPVMGFKTRYGIGVNPFAESSLQAPGARIQSGMP
O64375_9VIRU/3-495 LTEKWKELLEADGAEMPEIATATKQKIMSKIFENQDRDINNDPMYRDPQLIEAFNAGLNEAVVNGDHGYdPSNIAQGVTTGAVTNIGPTVmGMVRRAIPQLIAFDIAGVQPMTGPTSQVFTLRSVYGKDPLTG--KEAFHPTRQADASFSGQAAAST-IADFPTTGAATDGTPYKAEVTT-SGG--DVDTRYFLALGAVTLAVAGEMTATEYTDAVAGGLLVEIDAGMATSQAELQENFNGSSNNEWNEMSFRIDKQVVEAKSRQLKAQYSIELAQDLRAVHGLDADAELSGILANEVMVELNREIVNLVNSQAQIGKSGWTQGQGA-AGVFDFADAVDVKGARWAGEAYKALLIQIEKEANEIGRQTGRGNGNFIIAsRNVVSALSMTDTLVGPAAQGMQDGSMNTDTNQTVFAGVLGGRFKVFIDQYAVNDYFTVGFKGSTEMDAGVFYSPYVPLTPLRGSDSKNFQPVIGFKTRYGIQVNPFADPTKSA--EKVGNGAP