EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06908 alignment
(12 sequences with 178 aa)


Q9KC06_BACHD/1-177 M-KVITLTGYKAHELGIFSHNHRGITYIKKAFEQQILALIEEGVEWFLISGQLGVELWAAEVVIKLKQTHPHIQLAVLTPFLEQESQWQEASRKKYHDILEAADFVDSITKRPYEGPAQLRLKNEYLVQKSDGLLVLYDEDKPGSPSYYLEVAKKRQQQEPYDIRLITPHDLEWIAQE
YPSA_BACSU/1-177 M-KVLAITGYKPFELGIFKQDDKALYYIKKAIKNRLIAFLDEGLEWILISGQLGVELWAAEAAYDLQEEYPDLKVAVITPFYEQEKNWKEPNKEQYEAVLAQADYEASLTHRPYESPLQFKQKNQFFIDKSDGLLLLYDPEKEGSPKYMLGTAEKRREQDGYPIYFITMDDLRVTVEE
Q8Y613_LISMO/1-176 M-KSIAVTGYKNFELGIFKKDADEAVYIKETIKRHLLPLVEDGLEWVIISGQLGIELWAGDVVAELKADYP-IKLAILEPFEKQSANWNEANQLWASEVLEKADYHAFITKRPYESPAQFAARDGFIIDNTDGALLVYDLEKEGSPKFFYDRATQAKEQSNYYIDCIDFYALQEVVED
Q8CUT2_OCEIH/1-174 M-KILMVTGYKPMELNIFKEDDSRIQFIKASIEKRVREFLEEGLEWVIISGQMGVELWAADVVMELKEEYP-VQLGVFPPFENQDGRWPDALKEKYEELTMTADFFKPIYKGDYQGPYQFRTKDMWLIDKSDACLLLMDEEFPGSTKYFYDTLQ--KTAKDYPVFTITPQDIDDVVED
Q99U41_STAAM/1-178 MVKTVYVTGYKSFELNIFKDDAPEVHYLKQFIKHKIEQLLDEGLEWVLIQGQMGIELWTAEVVIELQRTYDSLKFAVITPFQGHTEKWNEHNQSKYANIIKHADYVDSIFHTSYQGPFQFKQADQFMLEHSDQTLLIYDEEQEASPKFFKQMLVDFMDKTNYTCDIVTFDELTAFIND
Q8CSJ2_STAEP/1-178 MVKTVYITGYKSFELNIYKDDAPEVYYLKQFIAHKLKHLLDEGLEWVLIQGQMGIELWSAEVVIELKKDFPDIKLGIITPFIGHTQRWNDKNQAKYTNIIQQADFTESIHHTEYMGAYQFKQADQFMLDHTDYTILIYDDEQEASPKYFKAMLVEFMEKTNYTCDIVTFDELTDFIND
Q9CI21_LACLA/1-171 M-NSLLIMGYTSFDLGIFNEKDIKVSIIKKTIRRKLINFLEEGLRWIIFTGNLGFEYWALEVAKELQTDYD-FQIGTIFSFETHGQNWNESNQVKLAA-FKQVDFVKYAFET-YESPSQFRQYNDFILENTEGAFVFYDEENETKLKYMVEKMK---QNTNYEVYLLDFEDLQETFEE
Q8K6D7_STRP3/1-171 M-TAILITGYRSFEIGIFDHKDPRVSIIKQAIRKDLIGYLENGVDWFIFTGNLGFEQWALEVANELKEEYP-LQIATIFLFETHGDKWNEKNQEVLSQ-FRAVDFVKYYFPN-YEQPTQFSQYYQFLLEKTEGAYVFYDTENETNLKYFLKKAK---DMPYYQLLLLTFDRLNDMSQS
Q8E1Q3_STRA5/1-172 MKSTILVTGYKNFELGIFQDKDPRITIIKKAIDKDFRRFLENGADWFIFMGNLGFEYWALEVALDLQKEYD-FQIATIFTFENHGQNWNEANKAKLAL-FKQVDFVKYTFPS-YENPGQFKQYNHFLINNTQGAYLFYDSENETNLKFLLEMME---KKEAYDISFLTFDRLNEIYEE
Q8DVL2_STRMU/1-171 M-TTILVTGYKNFELGIFQDKDPKITIIKKAIKRDFIHFLEEGVDWFVFMGNLGFEYWALEVALSLQTEYD-MQLATIFPFENHGEHWSEANQEKLFK-FKQTDFVKSSYKR-YQNSYQFKKYNQFLLDNTDRAYLFYDKDKETNLKYLYQMMT---AKDNYPVSLLTFEDLDDIVQD
Q8DR58_STRR6/1-171 M-ATALVLGYSAFDLGLFSDKDPRLKLIKKAIRKDLEAMAADGVSWLVFTGSLGFEYWVLEVAQEMKTEYG-FQLATIFAFETHGENWNEGNQMKLSR-FKQVDFVKYAYPR-YEHKGQLRDYQQFLLENTTSSYLFYDEENETKLAYFYQKMK---NQEDYFIKRLTFDQLNELAEN
Q88W96_LACPL/1-177 M-SRLWLSGYRSYELNVFGDQDDKLKVIKFALTNYLTTQIEDGMDWLITGGQLGIEQWTAEVGLTLKKTYPELKVAMMLPYGEFGGRWNENNQAKLQTLLAQVDFHAPVSKQPYENPQQLKNYQEFMVTHTDAATLVYDPDNPGKPTYDYDLIRNFSDTHPYPLTLIDFDWLQESANE