EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06737 alignment
(22 sequences with 81 aa)


Q99SG2_STAAM/153-231 VNVNAHLKQIAQRESGGNIHAVNPTSGAAGKY-QFLQSTWDSVAPAKYKGvSPANAPESVQDAAAVKLYNTGGAGHWVTA-
O54493_STACA/154-232 VQVNDHLKAIAQRESGGDIHAINSSSGAAGKY-QFLQTTWDSVAPAEYQGkPASEAPEAVQDAAAQKLYDTAGPSQWVTA-
Q9CF19_LACLA/136-199 GYSASEWAYIITHESNGGIDSVNSSSGAYGAF-QL-------LGHGEYA-.---GMTLAEQIAMASKLPA--G--SWVVYN
Q99XI4_STRPY/141-204 GVPQSTWEHIIARESNGNP-NAANASGASGLF-QTMPG-W---GST----.----ATVEDQVNAALKAYSAQGLSAWGY--
ISAA_STAAN/170-233 GVSASTWAAIIARESNGQVNAYNP-SGASG-LFQTMPG-W---GPTN---.-----TVDQQINAAVKAYKAQGLGAWGF--
ISAA_STAEP/172-235 GVSASTWEHIIARESNGQLHARN-ASGAAG-LFQTMPG-WGSTG------.-----SVNDQINAAYKAYKAQGLSAWGM--
Q88TF1_LACPL/157-220 GVDAGTWNHIINRESNWQPHVVNGASGAYG-LFQNIHIS----GG-----.-----SVQQQIDAAVNLYHAQGMQAWALY-
Q8CJX5_STRCO/378-453 GADHLNWQGLAACESGGRA-DAVDPSGTYGGLYQFDSATWHGLGGEG---.RPEDASAAEQTYRAQKLYVRSGADAWPHCG
Q9F2Q1_STRCO/40-117 AADSTNWDQVAECETGGAW-SQNSGNGYYGGL-QLSQDAWEQYGGLDYAP.SADQASRSQQIRIAEKIHASQGIAAWPTCG
P71755_MYCTU/48-122 KADDIDWDAIAQCESGGNW-AANTGNGLYGGL-QISQATWDSNGGVG---.SPAAASPQQQIEVADNIMKTQGPGAWPKCS
Q8VJI4_MYCTU/111-185 VAYSVNWDAIAQCESGGNW-SINTGNGYYGGL-QFTAGTWRANGG---SG.SAANASREEQIRVAENVLRSQGIRAWPVCG
Q9CBF8_MYCLE/43-117 VPREPNWDAVAQCESGRNW-RANTGNGFYGGL-QFKPTIWARYGGVG---.NPAGASREQQITVANRVLADQGLDAWPKCG
O07747_MYCTU/67-141 AGPSPNWDAVAQCESGGNW-AANTGNGKYGGL-QFKPATWAAFGGVG---.NPAAASREQQIAVANRVLAEQGLDAWPTCG
Q8NRY2_CORGL/274-351 VAANSVWDQLAQCESGGNW-AINTGNGFSGGL-QFHPQTWLAYGGGAFSG.DASGASREQQISIAEKVQAAQGWGAWPACT
Q8FQZ6_COREF/307-384 VAGGSVWDALAQCESNGNW-SINTGNGFSGGL-QFHPQTWQAYGGGQYAP.TAAGASREQQIAIAQKVQAAQGWGAWPACT
Q9F2Q2_STRCO/41-118 AATASEWDAVAQCESGGNW-SINTGNGYYGGL-QFSASTWAAYGGTQYAS.TADQASKSQQIQIAEKVLAGQGKGAWPVCG
Q8FR70_COREF/38-115 AAPDSDWDRLANCESGGNW-AINTGNGYHGGL-QFSPSTWRAYGGDEFAP.FAYQATREQQIAVAERTLAGQGWGAWPACS
O33049_MYCLE/37-114 PATDSEWDQVARCESGGNW-SINTGNGYLGGL-QFSQGTWASHGGGEYAP.SAQLATREQQIAVAERVLATQGSGAWPACG
Q8CK41_STRCO/41-118 AADAATWDKVAACESTDDW-DINTGNGYYGGL-QFTQSTWEAFGGTRYAP.RADLATREQQIAGAEKVLDTQGPGAWPVCS
O05594_MYCTU/279-356 VIDGSIWDAIAGCEAGGNW-AINTGNGYYGGV-QFDQGTWEANGGLRYAP.RADLATREEQIAVAEVTRLRQGWGAWPVCA
Q9L157_STRCO/45-121 APLRTDWDAIAACESSGNW-QANTGNGYYGGL-QFARSSWIAAGGLKYAP.RADLATRGEQIAVAERLARLQGMSAWGCA-
O86308_MICLU/41-115 AATVDTWDRLAECESNGTW-DINTGNGFYGGV-QFTLSSWQAVGGEGY--.-PHQASKAEQIKRAEILQDLQGWGAWPLCS