EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06707 alignment
(6 sequences with 252 aa)


Q98KZ1_RHILO/92-336 ADEPVDVELVLAVDVSLSMSADELEIQRHGYAAALTHDNV-LQAIADGAHGKIAVTYVEWAGTTWQRVIVPWTVIANRADAERVVAQLSAQPPNSARRTSISGALEFGSDLFAESGYEGTKRVIDISGDGPNNQGAPVNLTRDGVVRQGI-VINGLPLMTRGGL.SGAYDV---NDLDRYYSDCVIGGPGAFMIPVNDWTQFPEAIRRKLVLELAGPASPQWAAEEADHPPVVLTQDKPAADC-QIGEKMWR
Q89Y61_BRAJA/85-324 SRPAVDLELVIAVDISYSVQPDDLAAQREGYAKAIVSEEF-LRALRTGPVGKIALTYFEWSSTRDQDVIVPWRQIDGPEAAEAVAAEIMKAPIRRGSRTSISGAIKFAMPLFEQNPYRGARRIIDVAGDGPNNNGDPVATARDTAVQQGI-VITGLPVMINATP.PGQVDISHIDHIDWYYEDCVIGGPGSFVVPITDRENFKEAIRTKLALEVAGRTPDQSPPPSV--------DKKPRVLC-TIGEKLWQ
Q89RX1_BRAJA/44-280 DAQTVDVELILAVDVSYSMDMDELAIQREGYAQAIQSKEF-LQALKMGPNGRIAVTYFEWAASTDQKIIIPWRLIDGPETADAVATEIMKTPIRRASRTSISGAITFAMPLFDEDPYRGLRRVIDISGDGPNNNGGPVTVARDAALEKGI-VINGLPIMVKEPS.YSTMDI---DNLDYYYEDCVIGGPGSFVITIKDREKFKEAIRTKLLMEVAGRVPERPVMRVA--------DKEPRVSC-LIGEKIWS
Q98G05_RHILO/26-257 GAPAVDVELVLAVDISLSMDEKEFALQRAGYVEALRHPDF-IQAVRSGNAGRIAIAYFEWAGTVRDDAVIDWQIIDSAQSANSFADKVAARPFRSFRGTSISTAIAFGTGLFGRTNFAGERSVIDISGDGPNNIGPPVTAMRDAATAKGI-VINGLPILINPSP.----TF---KHLDQYYAQCVIGGPGSFVLPIHTAAEFSTAIRRKLILEVSGIQGKASIIP---------VDADAPIDC-LQGERDRR
Q98HK0_RHILO/111-350 DLADVDLQLILAVDVSPSMSKVEQKVQRDGYVGAFRHADI-ARALKSGERGRIAVLYLEWAGPRQQTVVMPWTIVESLDDALILADRLAALPLTEGRGTSISGALSAAHALFAKSGLRSPRRVIDVSGDGPNNAGLPLQLVHDALTTGGV-TINGLAISLRAADtLDSFGP---HFIELYYESCVIGGSNAFVVTVENTADFANAIRKKLVNEIAGLSAKVQPATYR-------SHSRPVVDCDTIGETPGR
Q8YM96_ANASP/32-255 AATFVDTELSLLVDVSSSISTSEFNLQKQGYVDAFNNADLFNNFISKGNIGKIAVNLIYWSSATQQQQSVGWTLIDSVEASQNFANAINATTRPFGGGTVIGSAIDFATPLIFNNEFESNRQVIDVSGDGRSN-AVTTAAARDAALAAGVDAINGLVIGNS---.---------TSLFNFYNNNVKGGAGSFVLQANTFQDFADTVELKLRREIISEPPTTTP--------------EPATLIGLFGLGAFG