EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF06134 alignment
(5 sequences with 417 aa)


RHAA_BACHD/1-417 MSMKSQFERAKIEYGQWGIDVEEALERLKQVPISIHCWQGDDVGGFELSKGELSGGIDVTGDYPGKATTPEELRMDLEKALSLIPGKHRVNLHAIYAETDGKVVERDQLEPRHFEKWVRWAKRHGLGLDFNPTLFSHEKAKDGLTLAHPDQAIRQFWIDHCIASRKIGEYFGKELETPCLTNIWIPDGYKDTPSDRLTPRKRLKESLDQIFAAEINEAYNLDAVESKLFGIGSESYVVGSHEFYLSYALKNDKLCLLDTGHYHPTETVSNKISAMLLFHDKLALHVSRPVRWDSDHVVTFDDELREIALEIVRNDALDRVLIGLDFFDASINRIAAWTIGTRNVIKALLFAMLIPHKQLKEWQETGDYTRRLAVLEEFKTYPLGAIWNEYCERMNVPIKEEWLKEIAIYEKEVLLQR
Q8ESX0_OCEIH/1-417 MDVKQNYEQAKKQYEKWGVNVEDALEKLKQIPISIHCWQGDDVTGFEVNQQELSGGIDVTGNYPGKATTPEELRDDLDKALSLIPGMHRVNLHAIYAETNGEAVERDEIEPKHFENWVKWAKENGLGLDFNPTLFSHPKADDGLTLAHPNKEIRDFWIRHTIASRKIAAYMGKELGTSALTNIWTPDGYKDIPSDRLTPRKRLEDSLNQIFEEEIDKEYNVDAVESKLFGIGSEAYVVGSHEFYMGYALKNNKLCLLDTGHYHPTEMVSNKISSMLLYSDELALHVSRPVRWDSDHVVILDDELREIGLEIVRNDALDKVRIGLDFFDASINRIAAWTIGTRNMIKSLLYALLTPNEHLKQLQEEGNFTDRLAIMEELKTYPFGAIWDYYCESMNVPVGESWLTEVKEYEKEVLSKR
RHAA_BACSU/1-417 MTIKANYDSAKQAYEKWGIDVEEALRQLEQVPISIHCWQGDDIEGFEVNKGELSGGIDVTGNYPGKAQTPEELRRDLEKALSLIPGKHRVNLHAIYAETNREAVERDELKPQHFENWVKWAKNLGLGLDFNPTLFSHEKAADGLTLSHPDPDIREFWIRHCIACRRIGEYFGKELGTPCLTNIWIPDGYKDIPSDRLTPRKRLKESLDRIFSEEISEQHNLDSIESKLFGLGSESYVVGSHEFYLAYALTNHKLCLLDTGHFHPTETVSNKISSMLLYTDKLALHVSRPVRWDSDHVVVLDDELREIALEIVRNHALEKVAIGLDFFDASINRVAAWTIGTRNMIKALLYALLLPNGYLKQLQEEGRYTERLALMEEFKTYPFGAIWDSYCEQMGVPVKEAWLYDIKEYEQQVLLKR
RHAA_LISMO/5-420 TEINKRYQVAKERYQAIGVDTEKALKTLKDIKISMHCWQGDDVKGFLNPDGELTGGIMATGNYPGAAHTPKQLRQDLEKAYSLIPGKHKLNLHAIYVDTD-EKVDLNEIEPKHFTPWVEWAKEQGLGLDFNPTFFSHPMFKDNYTLASPDKEVRDFWIEHGKRSRKISEYFGKELGQTSINNFWVPDGIKDCPIDRYTPRKRLMEALDEVFAEKLDEKYTQEAVESKLFGLGAEAYTVGSHEFYMGYGITRDKLICLDAGHFHPTEVISNKLSSLALFSKGVMLHVSRPVRWDSDHVVIMDDELIEIGRELVRNDLLGITNIGLDFFDATINRIAAWVVGTRNTQKSLLKALLEPTADLKKMELENDFTSRMAITEELKDFPFGDVWNYFCEINGVPVGLDWLKEVKAYEEDVLLKR
RHAA_ECO57/3-418 TQLEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVSGFENPEGSLTGGIQATGNYPGKARNASELRADLEQAMRLIPGPKRLNLHAIYLESD-TPVSRDQIKPEHFKNWVEWAKANQLGLDFNPSCFSHPLSADGFTLSHADDSIRQFWIDHCKASRRVSAYFGEQLGTPSVMNIWIPDGMKDITVDRLAPRQRLLAALDEVISEKLDPAHHIDAVESKLFGIGAESYTVGSNEFYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVRWDSDHVVLLDDETQAIASEIVRHDLFDRVHIGLDFFDASINRIAAWIIGTRNMKKALLRALLEPTAELRKLEAAGDYTARLALLEEQKSLPWQAVWEMYCQRHDTPAGSEWLESVRAYEKETLSRR