EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05971 alignment
(6 sequences with 316 aa)


Q9V790_DROME/7-297 NQKIVGMHPRNVLRTQP-DYTKMAIKYKDFRQQCQLELNGKVSVNFRNEKTLRELTKMLLKEYYDLDV-DFAPGSLVPTLALRLNYILWLEDLMEPLNLQ------NIRGIDIGCGSSCIYSLLGAKKNGWHMLALESKPQNIEYAKENVKRN-HMESLIEVYAQPDNTNIFKSYFEQDQQQLQYQFCLCNPPFFDSNLPNPLGGNTRNPE--RRP--------------APNNARTGSQEELTCVGGEVQFVQRIIDESLENKERVRIFTTMLGVKANVPRILDYLKELQVANVSTTEFHQGHTTRWAVAWSFHS
Q96T16_HUMAN/1-291 MALSKSMHARNRYKDKPPDFAYLASKYPDFKQHVQINLDGRVSLNFKDPEAVRALTCTLLREDFGLSI-DIPLERLIPTVPLRLNYIHWVEDLIGHQDSD-KST--LRRGIDIGTGASCIYPLLGATLNGWYFLATEVDDMCFNYAKKNVEQN-NLSDLIKVVKVPQKTLLMDAL--KEESEIIYDFCMCNPPFFANQLEAK-GVNSRNP---RRP--------------PPSSVNTGGITEIMAEGGELEFVKRIIHDSLQLKKRLRWYSCMLGKKCSLAPLKEELRIQGVPKVTYTEFCQGRTMRWALAWSFYD
Q9KRM2_VIBCH/43-350 AAVKSGLHPRNRHRGQY-DFPALIKVVPELQSHVMKNPKGQWTINFADPISVKLLNKALLVLHYGVTYWDIPEGFLCPPIPGRADYIHRVADLLLKGNPQL--NHSQVRALDIGVGANCIYPIVGVTEYGWSWVGSDVDPVSIQQASLIVQSNSKLQGHIECRLQKNSQHIFNGIIG--ANE-RYTVTTCNPPFHASLADAQ-QGTQRKLTNL-QANQRKKGRLATPTLSHSRLNFGGQKAELWCPGGEAAFIGKMAVESQQFAQQVLWFRTLISKGDNVRGMKKQLEKLGAQSIHVIEMAQGQKISRFIAWSFQN
Q9HXG4_PSEAE/13-314 RKSASPLHPRNRHLGRY-DFPRLIAGSPELERFVILNPYGRQSIDFADPAAVKAFNRALLQQFYDVREWDIPDGYLCPPIPGRADYLHYLADLLGASHDGLIPRGPGLRALDVGTGANCIYPLLGHHEYGWRFVGADIDPQSLASAAAILAANPRFAAAIELRRQPDRRQIFQGLIG--VDE-RFDMTLCNPPFHASLDEAT-RGSRRKWKNLGKLDP---------TRTLPLLNFGGQGAELYCEGGEAAFLAGMAEESRAFATQVFWFTTLVSKASNLPNLQERLKTLGASDIRVVDMAQGQKQSRFVAWTYLD
Q8ZDP0_YERPE/23-323 PKEKSGLHPRNRHCSRY-DFDALSVSCPELIPFLAPTAYGDISVDFADPLAVKMLNKALLKHFYGIEYWDIPADSLCPPIPGRADYVHHLADLLASCNGEVIPKGKNIALLDIGVGANCIYPIIGQREYGWRFTGTDIDSHALSAAKMVVSMNPTLKNTLRLKQQKDPHAIFEGVWA--VNE-RYDATLCNPPFHGSAEEAA-ATTRRKLHKLGK-NE---------VAAKPVQNFGGKNSELWCEGGEEGFVSRMVAESVAKAQNCFWFTSLISKKTTLPAIYHALRYVKAVEVRTIEMAQGQKVSRFVAWTFLT
Q8X7W6_ECO57/29-323 SAQKPGLHPRNRHHSRY-DLATLCQVNPELKQFLTLTPAGEQSVDFANPLAVKALNKALLAHFYAVANWDIPDGFLCPPVPGRADYIHHLADLLAEASGT-IPA--NASILDIGVGANCIYPLIGVHEYGWRFTGSETSSQALSSAQAIISANPGLNRAIRLRRQKESGAIFNGIIH--KNE-QYDATLCNPPFHDSAAAAR-AGSECKRRNLGL-NK---------DDA---LNFGGQQQELWCEGGEVTFIKKMIEESKGFAKQVMWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQGQKQSRFIAWTFMN