EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05933 alignment
(17 sequences with 48 aa)


ATP8_YARLI/1-48 MPQLVPFYFTNQIFYGFASLSVIVYLFSIYILPHYLEIYVTRIFITKT
ATP8_KLULA/1-48 MPQLVPFYFLNQLVYGFALVTILLVLFAQYFLPQILRLYVSRLFISKL
ATP8_YEAST/1-48 MPQLVPFYFMNQLTYGFLLMITLLILFSQFFLPMILRLYVSRLFISKL
ATP8_CANPA/1-48 MPQLVPFYFMNLLTGGILAISLLLYFVATYLLPNILRLLIARNIIIKL
Q9B8D3_CANAL/1-48 MPQLVPFYWMNLLTTGIAAVSILLYLSATIILPNVLRLLVARAIIVRV
Q8HQ91_SCHOT/1-48 MPQLNPLYFLNILSFGFVIFSILLYVSSVYILPRYTELYISRSIFTSL
ATP8_SCHPO/1-48 MPQLVPFYFINILSFGFLIFTVLLYISSVYVLPRYNELFISRSIISSL
Q94ZJ7_SCHCO/1-48 MPQLIPFYFLNQIVFTFVTLFLVVYLLSKYFLPLFTYLQVIRNYITKL
Q8SHQ8_TRIRE/3-50 MPQLTPFYYMNEIVFAFAIIVILLFILSKYILPRIVRLFLSRMFINKI
Q8HG52_9HYPO/1-48 MPHLTPFYYVTDIVFTFAIIVIVLYISSKYISPWLVRFFLSRMFISAL
Q8HHC9_CRYPA/1-48 MPQLVPFYFINEVIFTFAVIAITVYMMSKYILPRFVRLFLSRTFISKL
ATP8_NEUCR/1-48 MPQLVPFYFVNEITFTFVIITLMVYILSKYILPRFVRLFLSRTFISKL
ATP8_TRIRU/1-48 MPQLIPFFFFNQVVFTLISLSFIFFVFSKYILPWIVRLYVSRNQYNSL
ATP8_EMENI/1-48 MPQLVPFFFVNQVVFAFIVLTVLIYAFSKYILPRLLRTYISRIYINKL
Q8HMY8_SCHJP/1-48 MPQLLPFYIKHMILVGFLVLIILIYLISKYFLPRLNELYIARYKLSET
Q950M5_9FUNG/1-48 MPQFSPLWFINIISWTFAIISFLVWYNQAIILPSIVRLNLSRTIMLFN
Q37398_ALLMA/1-47 MPQLEPLYFINSISWTYLAFGITFVLVSKVFLPLNLKTQMIRLTLIQ-