EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05826 alignment
(7 sequences with 103 aa)


Q9V4L3_DROME/27-125 TVPGTKWCGPGNIAA-NYDDLGTEREVDTCCRAHDNCEEKIPPLEEAFGL-RNDGFFPIFSCACESAFRNCLTALRNG-HSLALGKIYFNTKEV-CFGYGHPI
Q9V4L2_DROME/44-143 TVPGTKWCGPGNTAA-NFEDLGRERETDKCCRAHDHCDEIIESHGALHGLPTNTDWFPILKCTCEQQFINCLQAVNSI-TAKTLGRIYYGS-RSRCFANGHPT
PA2G3_HUMAN/152-251 TMPGTLWCGVGDSA-GNSSELGVFQGPDLCCREHDRCPQNISPLQYNYGI-RNYRFHTISHCDCDTRFQQCLQNQHDSI-SDIVGVAFFNVLEIPCFVLEEQE
PA2_APIME/35-135 IYPGTLWCGHGNKSS-GPNELGRFKHTDACCRTHDMCPDVMSAGESKHGL-TNTASHTRLSCDCDDKFYDCLKNSADTISSYFVGKMYFNLIDTKCYKLEHPV
Q8SZ42_DROME/135-234 IIPGTKWCGTGDIAE-TYSDLGSEMAMDRCCRQHDLCPIKIRAYQNKYEL-MNDSLYTKSHCICDDMLFSCLKMTNTS-ASQLMGSIYFNLVQVPCLDGRSNH
Q8SXC6_DROME/42-141 IYPGTKWCGPGTAAT-SYDDLGAHAREDRCCREHDMCPDVLNVGECRRGL-CNRGTFTRSHCDCDARFRRCLQAANTE-TANTLGAIFYNVVQVTCFQERSPC
Q8MR17_DROME/108-208 IAPNTRWCGRGNLANGTYNDLGGASKADKCCRKHDHCKMWIDGMSNRYDL-FNYRPYTLSHCSCDLRFRTCLKMAGDE-DANAIGKLFFNVVQTQCFGLKAET