EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05578 alignment
(4 sequences with 211 aa)


Q04232_BVDV/149-359 GPAVCKKITEHERCHVNILDKLTAFLGIMPRGTTPRPPVRFPTSLLKVRRGLETGWAYTHQGGISSVDHVTAGKDLLVCDSMGRTRVVCQSNNKLTDETEYGVKTDSGCPDGARCYVLNPEAVNISGSKGAVVHLQKTGREFTCVTASGTPAFFDLKNLKGWSGLPIFEASSGRVVGRVKVGKNEESKPTKIMSGIQTVSKNTADLTEMVK
O09461_9FLAV/1588-1798 GPAVCKKITNHEKCHVNIMDKLTAFFGIIARGTTPRAPVRFPTALLKVRRGLETGWAYTHQGGISSVDHVTAGKDLLVCDSMGRTRVVCHSNNKMTDETEYGIKTDSGCPEGARCYVLNPEAVNISGTKGAMVHLQKTGGEFTCVTASGTPAFFDLKNLKGWSGLPIFEASSGRVVGRVKVGKNEDSKPTKLMSGIQTVSKNQTDLADIVK
Q68287_9FLAV/2-212 GPAVCKKVTEHEKCTTSIMDKLTAFFGVMPRGTTPRAPVRFPTSLLKIRGGLETGWAYTHQGGISSVDHVTCGKDLLVCDTMGRTRVVCQSNNKMTDESEYGVKTDSGCPEGARCYVFNPEAVNISGTKGAMVHLQKTGGEFTCVTASGTPAFFDLKNLKGWSGLPIFEASSGRVVGRVKVGKNEDSKPTKLMSGIQTVSKSTADLTEMVK
O11993_BVDV/1590-1800 GPAVCKKITGHEKCHVNILDKLTAFFGVMPRGTTPRAPVRFPTALLKVRRELETGLGLTHQGGISSVDHVTTGKDRLVCDSMGRTRVVCQSNNKLTDETEYGVKTDSGCPDGARCYVLNPEALNISGSKGAVVHLQKTGGEFTCVTASGTPAFFDSKNLKGGSNPPIFEASSGRMVGRGKVGKNEESKPTKLTSGIQSRGKNKADLTEMVK