EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05182 alignment
(8 sequences with 64 aa)


Q9FGU0_ARATH/336-398 FEVDIDSFEEKPWRYPGVEMTDYFNFGLNEESWKDYCKQLDQHR-IQTTMQSRIRVYESGRTDQ
Q9C834_ARATH/158-221 FDVNLDVLEKKPWRDPGTDTSDFFNFGLNEQSWKDYCKPLGRAIEVRGGTLERIPSADLRRPRD
YAAA_SCHPO/119-178 FEIDLESFDDKPWRKPGADISDYFNYGFDEFTWAAYCAKQTT---LRDD-FSPQKFMASLAQIP
Q9VN31_DROME/218-280 HEFSIDSLEEKPWRKPGADITDYFNYGFNEETWRAYCERQKRFRVAESG-VGLASLTQNVNQNA
Q99LH0_MOUSE/152-211 LEVDLDSFEDKPWRKPGADLSDYFNYGFNEDTWKAYCEKQKR---IRMG-LEVIPVTSTTNKIT
O16293_CAEEL/133-193 YDLDLAQMEDRPWRKPGADITDYFNYGFTEETWNLYCERQKK---LRIEFAGNQKAANEALFSS
FIP1_YEAST/178-238 TTIDPEVLKEKPWRQPGANLSDYFNYGFNEFTWMEYLHRQEK---LQQDYNPRRILMGLLSLQQ
Q9BHY5_LEIMA/63-123 FGYDIALMAKRPWAEPGAKLSDYFNYGFNEQSWRVYCAMQEK---GEESLLANATAVLQKLELA