EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05137 alignment
(11 sequences with 177 aa)


P74187_SYNY3/6-181 VNFLKDRNSDVVRSTQTTTITLTGDDLQKQMPLYIGAGVMVLLPALAGLGVLLINWQKGVAQTNIQQLETELSQLQGEQQKIQEVEAKTAAAHQEADGLIGVFNQIKPWSALFQEITNQLPQEVQLQSI.QQEGNVITLSGFAGNYGSLNDFLLTLQSSKFLQANKTKLMTANAAAL
Q9KNU7_VIBCH/7-168 VNLLPWRD--------------ARREAHKRRFLGLVTLGVLLAVLMQFAAGEYLGGQMALQQERIGYLQQHIFSLDQQIAKLKIAEEEHKALLTRLTVVEQLQQKRNKTTEFMNQMPNLIPEGVYVDKI.KMNGHQIEITGISDSTARLATMLDNLEKSDKLTDVEMHEIVSGNKRF
Q9AM62_9GAMM/4-165 INLLPWRD--------------KLREKRKKEFLVFSILVGLLGCAAVLMGWFYFGHKLNDQEQANQLILTTNQGLDQQLKSLDGLQQQRNAIVERMKLIQGLQAQRPVTVRLIDELVRVTPSNMYLTKF.TRTGDKFTIEGKAESPNTVAELLRNLEASAWYRNAFMNSFLAAEDNK
Q9PGD2_XYLFA/4-165 INLLPWRV--------------ERRKQREREFYMMLGFSTLVGILVSALVWFYYDAQVSGQNDRNAFLASEIEGVKAQNREIDQLDKKKEHLLARKKVIEELQSNRSQMVHLFDSLARTIPDGVVLTTI.KQEGNSVTLQGRSQSNVRVSTYMRNIEGSGWMTNPDLSIIEAKEQDK
Q52540_PSESX/4-165 INLLPWRE--------------ELREERKKRFLTALVGVLVVSVGILFLIDRYVSNAIEHQMARNAFVQTQIAQLDIRIKEISDLKARRKQLLERMKIIQDLQGNRPITGRVFDQLARTLPDGVYFSQV.KMTDKLIAISGAAESNNRVSDLMRNLEASDWLEAPSLTEVKATTAGA
Q51352_PSEAE/4-165 INLLPWRE--------------ELREQRKQQFLVILGGVLVASAALVFLGDQYFTAAIENQNARNDFLRKEIVVLDARIKEISELKSRRQQLLERMKIIQDLQGNRPIIGRVFDQLVRTLPDGVYFTDL.KMTGKNIAIAGAAESNNRVSNLMRNMDASEWLTAPTLNEVKAVTQGA
O05129_NEIGO/7-169 INLLPYRE--------------EMNKRKQQQFKTLMYGAVLTGVAAVAATYLFIDNMINKQSEKNTLLEISIAHLDTELSEIQKLKQEKDAFLIKKNKIGELQIKRLQAAKILDSLNVAVPGSTYLTSLdAVTADTYRLSGRTSSDNRVAAMMRGDAQYRHIQATRIVKHQEKQFAS
Q988B3_RHILO/184-335 LAAI-WPP--------------TARDRRARTAWIAALSVLAGAVLVTFAHAHWRAWQAEAE------LDTQIADAQVLAKAARASLQKRQAGIERIEKIRQEKKTTASLVRVWAELTHLLPDTAWLTDL.SAKGDDLTISGFSTSA---AELIQPIDASPLFSAPEFASPVVKVPGQ
YRFC_SHIFL/5-162 INFLPWRQ------------------QRRTAFLRFWLLMFVAPLLLAVGITLILRLTGSAEARIDAVLLQAEQQLARSLQITKPRLLEQQQLREQRSQRQRQRQFTRDWQSALEALAALLPEHAWLTTI.SWQQGTLEIKGLTTSITALNALETSLRQDASFHLNQRGATQQDAQGR
Q9PD55_XYLFA/204-357 VNLLPPVQ--------------RWRCSDPMRRWNL-VLAAVALLLVATAGALLLNNRIRVAEE----LRLQVQAHAISARRVAAERQRLVTLIEGVRFLDERRTLRPTVIEVWEELSRRLPNGTYLEKF.AIEDGQLHLMGMSNDA---SSLVRLLEGSKLWRTPSLSSVLQSNVGS
GSPL_XANCP/195-348 VNLLPPAR--------------RLRRSDPMQRWNL-LLAVAALVLLAVAGWLLLDNRRQAADD----LRAQVQANAGRARQVAAERQQLLELVEGAAFFQEQRATRPTSVEIWDELSRRLPSGTYLEKF.SVEGGQLQLIGLSKEA---SSLVRRLEGSPLWHTPSLTGVLQSDAGR