EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF05038 alignment
(4 sequences with 194 aa)


CY24A_PIG/1-191 GQIEWAMWANEQALASGLILMTGGIVATAGQFTQWYLGTYSIAAGVLVCLLEYPRGRRTKGSTMERCEQKYMTKVVKAFGPLSRNYYIRAFLHLGLSVPAGFLLATILGTACLAIASGIYLLAAIRGEQWTPIEPKPKERPQVGGTIKQPPSNPPPRPPPEARKKPGEEAVAGVPR...GAPRKTPCPVTDEVV
CY24A_BOVIN/1-190 GQIEWAMWANEQALASGLILITGGIVATAGQFTQWYLGAYSIAAGVLVCLLEYPRGKRSKGSTMERCGQKYLTRVVKLFGPLTRNYYIRAFLHLGLAVPAGFLLATILGTACLAIASGIYLLAAIRGEQWSPIEPKPKERPQIGGTIKQPPSNPPPRPPAEARKKPSEE-AAGVPT...GGPQENPMPVNDEVV
CY24A_HUMAN/1-194 GQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVFVCLLEYPRGKRKKGSTMERWGQKHMTAVVKLFGPFTRNYYVRAVLHLLLSVPAGFLLATILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPPPRPPAEARKKPSEEEAAAAAGgppGGPQVNPIPVTDEVV
CY24A_MOUSE/1-191 GQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIAAGVLICLLEYPRGKRKKGSTMERCGQKYLTSVVKLFGPLTRNYYVRAALHFLLSVPAGFLLATILGTVCLAIASVIYLLAAIRGEQWTPIEPKPKERPQVGGTIKQPPTNPPPRPPAEVRKKPSEGEEEAASA...GGPQVNPMPVTDEVV