EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF04333 alignment
(12 sequences with 213 aa)


VACJ_HAEIN/27-230 QVSERNDSLEDFNRTMWKFNYNVIDRYVLEPAAKGWNNYVPKPISSGLAGIANNLDEPVSFINRLIEGEPKKAFVHFNRFWINTVFGLGGFIDFASAS-KELRIDNQRGFGETLGSYGVDAGTYIVLPIYNATTPRQLTGAVVDAAYMYPFWQWVGG------PWALVKYGVQAVDARAKNLNN-.AELLRQAQDPYITFREAYYQNLQFKVN
Q9CKV4_PASMU/26-226 KTGERKDPLEGFNRTMWDFNYKVVDPYLLKPVATGWKEYVPTPVKSGLTNVANNLDEPASFVNRLLSGEFKKAMTHFNRFWINTVFGIGGLIDVASYS-PPLRVENQSRFGDTLGRYGVETGSYVMLPLYGPATPRQDIGNLADTT--YPMLSLLG-------PWSLLKSGVQIIDGRAKALDK-.DALLEQSQDPYITFREAYFQNLEYRVK
VACJ_ECOLI/24-226 DQQGRSDPLEGFNRTMYNFNFNVLDPYIVRPVAVAWRDYVPQPARNGLSNFTGNLEEPAVMVNYFLQGDPYQGMVHFTRFFLNTILGMGGFIDVAGMANPKLQRTEPHRFGSTLGHYGVGYGPYVQLPFYGSFTLRDDGGDMADGF--YPVLSWLTW------PMSVGKWTLEGIETRAQLLDS-.DGLLRQSSDPYIMVREAYFQRHDFIAN
Q9KQF0_VIBCH/33-232 PHSQVNDPLESFNRQMWTINYDYLDPYVVRPVSLFYVGYVPKPVRSGIANFLSNLDEPASMVNNLLMGNGTKAVDHFNRFWINTSFGLLGLIDIASEAG--IKKYDDKAFSDAVGHYGVGNGPYLMVPGYGPYTVR-EVTDVVDGM--YFPLAYLNI------WAGVGKWALEGMETRAALVSQ-.EALLQDSPDPYSLARDAYLQRQAFKAE
Q9ZE54_RICPR/38-239 GCLEVYDPYEKFNRKVFAFN-SVLDYIIFRPLAVGYKNITNDYIKARVNSFISNVYTPLTVVNYGLQLNYDKTMKSVWRFLINTTLGIGGLFDVASKVG---LQSDRQTFGSTLAHYGVAPGPYLVLPIIGSTNARDMTDSVITNYAINPLMYYTHN------DFDLWILAVSKITDRYIVLPFS.DYVMKNSTDPYVAIRSALHRAREASVQ
Q9Z674_ZYMMO/31-238 DTLAQTDPLEKFNRKVWNIN-SKADKLVMQPVAKYYNKKVPEPVRKAIIRIFANLEEPFNAINNLLQGKPYLAGKNIARLAINTTVGIGGIRDTATKIG--VVSTVED-FGQTMARWGMNGGPYFVLPFMGPTTMRDAVGTGIAQWA-DPFSYCVRECHFVPNAATYAIAVVSVVKMRAQMAESGaDSFLESSLDPYAAARSAFLQHRAPRSW
Q9A274_CAUCR/56-258 AGPAANDPLEGFNRASFKLG-MGLDRALLAPITHGYMAVTPRVVRDRVSLVIYNMGEPNTVMNQVLQGKPRQAVRSSTRFVVNSTVGVAGLFDVAAKMG--LPPRGAD-FGQTFGRWGAGPGAYIYVPLMGPLNVRDGVGRALDIVT-DPVSLFVGGL---DTDFGRARTAITVVDLRATTDSAY.EALKDAS-DPYVTTRSAYAQYREAFVR
Q9PMS9_CAMJE/32-232 QNYQVNDPLSGYNKAMTSFN-VALYDYGLRPVLKGYNAITPEFIRLGARNFFDNLLAPLRFVSNVLQFKFEEAGEEFKRFTANTIMGFGGLMDVASKMG--LKKHPAD-LGTVLAHWGVGSGFHIVLPILGPSNLRDTLTLPATWY--ASFTAYIDP-----TWASIAISAYGFGNELSFRLDEI.DEIYHNTPNLYPFLRDAYEQRRNELSK
Q9I043_PSEAE/29-226 LAASEEDPWESINRPIFTFN-DTLDTYALKPLAQGYQKVTPNFVQDGVHNFFNNLGDVKNLANNLLQAKFHNAGVDTSRLLFNSTFGLAGLIDVATPMG--LQRNDED-FGQTLGYWGVGSGPYVMLPFLGPSTLRDAPAKIPDIY-VSPYHYMDDV------RARNVMFGINTVDTRANLLKS-.EKLISG--DKYIFIRNAYLQNREFKVK
Q9HZ01_PSEAE/64-264 DALNMYDPWESWNRRVYHFN-YRFDEWVFLPVVRGYEYVTPHFVRSGVSNFFDNLGDVPNLLNNLAQLKGKAAMETTARLLFNTTFGVLGLWDPATRMG--LHKRSED-FGQTLGFYGVGSGPYLVLPILGPSNLRDTGGLVVDYVGEYQVNYLNVP------QASGDHPEITALRVVDKRYNT-.SFRYGQMNSPFEYEKLRYIYTEARKLQ
Q9PG86_XYLFA/111-310 DTHTTYDPWERYNRAMHQFN-VVIDRNLARPLANAYVHVVPKKAQVGVTNFFNNLSSPLTMVNQVLQNHPVYALQTLGRFLLNSTLGLGGILDPASAAK--IPRRTEN-FGQTLALWGWYNSRYFELPLFGPRTVRDTFGLAGDLP--LSLLRRIDN-----NTWRYSLQGLQLVDTRARLLSF-.DNMRDGAVDDYALTRDAWLQRRNYQIQ
Q9JW90_NEIMA/21-222 AETRPADPYEGYNRAVFKFN-DQADRYIFAPAARGYRKVAPKPVRAGVSNFFNNLCDVVSFGSNILRLDIKRASEDLVRVGINTTFGLGGLIDIAGAG---GIPDNKNTLGDTFASWGWKNSNYFVLPVLGPSTVRDALGTGITSVYSPKNIVFRTP------VGRWGTTAVSAVSTREGLLDLT.DSLDEAAIDKYSYTRDLYMKVRARQTG