EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03884 alignment
(8 sequences with 65 aa)


Y891_HAEIN/2-61 IEVP----CPICQKSVPWINESTFRPFCSKRCQLIDLGEWAAEEKAIPSDTA-DFAMDPNVSDEW
Y089_PASMU/6-65 FSVP----CPICQKQVEWSDKSPFRPFCCKRCQLIDLGEWAAEEKAIPCESA-DFAMNDEQEDWR
YACG_ECOLI/5-64 ITVN----CPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGD-LSESDDWSEEPK
Y2429_VIBCH/5-65 LTIVK---CPRCGTDVEWGEQSPHRPFCSKQCQMIDFGEWADEEKAIPGAPD-MSDSDGWSEDQY
Y4530_PSEAE/5-64 LTVE----CPTCGAPVEWKSDNKYRPFCSDRCKLIDLGAWAAEEHAIPGDTL-EDDIFSADLPPR
Y330_NEIMB/5-69 RQTRLQVKCPTCQTAVVWKPENAFRPFCSQRCKLIDLGGWADGKYTVSGQTESLPEISEPDMAYR
Y6451_RHILO/10-65 LRPKRP--CPECGKPSAR----DTFPFCSARCKDIDLNRWLKGAYVIKARDDEEE--PDADEPK-
Y2340_CAUCR/1-57 MSAK----CPICAKPVDS----AFRPFCSKRCADVDLQRWLSGRYVVAGGDDDEENPPSQDINRE