EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03678 alignment
(13 sequences with 247 aa)


O11421_9ADEN/586-819 NATNDQNFSDYLGAVNNLYQIPANSTSVVVNVPDRSWGAFRGWSFTRIKARETPAIGATKDPNFTYSGSIPLLDGTFYLSHTFNRVSIQWDSSVPWPGNDRLLTPNWFEIKRNVNADPEGYTMSQSSITKDWFMVQMAANYNQAYQGYSLP---HTKFYDFLSNFEPMTRQIPDYS-KYFDLYTQYLQDPKKM-.-----PIWNNSGVQQMTNSPALLENTGHLYMANWPYPLIGTA--AVESQITE
Q83905_ADEO7/585-820 NATNDQNFADYLGAVTNLYQIPANTNTVVVNVPDRSWGAFRGWSFNRIKASETPMIGATKDPNFTYSGSIPLLDGTFYLTHTFQRVSIQWDSSVPWPGDDRLLIPNWFEIKRDPNMDAEGYTMSQSTITKDFYLVQMAANYNQAYQGYKLPV--HSKYYGFLENFQPMSRQVPIYGNGTYDLYTAYITNQRTM-.-----QIWNNSGLESKTSNPPMLSNTGHLYVANWPYPLIGPN--AIENQQTE
O71149_9ADEN/585-820 NATNDQNFADYLGAVNNLYQIPPNTSTVVVNVPDRSWGAFRGWSFNRVKASETPMIGATKDPNFLYSGSIPYLDGTFYLTHTFQRVSIQWDSSVPWPGDDRLLIPNWFEIKRDYSIDAEATNMSQCNITKDWYMIQMAANYNQAYQGYKLPI--SHKYYGFLENFQPMSRQVPIYGGDLYDLYTEYIKNPNLM-.-----QIWNNCGLQQKTSGIPLLENSGHLYVANWPYPLIGKH--AIESQKLQ
HEX_ADEP3/621-849 NDTNNQTFIDFLSSANMLYPIPANVTNLPISIPSRNWAAFRGWSFTRLKHNETPALGSPFDPYFTYSGSIPYLDGTFYLGHTFRRISIQFDSSVAWPGNDRLLTPNEFEVKR--TVDGEGYTVAQTNMTKDWFLVQMLAHYNIGYQGYHLPEGYRDRTYSFLRNFEPMCRQVPDYANHKDEYLEVPTTNQF---.--------NSSGFVSAA--FTAGMREGHPYPANWPYPLIGED--AVQTVTQR
HEX_ADECC/588-815 NDVNDQSFADYLSAANMLYPIPANTTNLPISIPARNWAGFRGWSFTRIKQRETPALGSPYDPYFTYSGSIPYLDSTFYLSHTFRRVSIMFDSSVSWPGNDRLLTPNEFEIKR--YVDGEGYNVAQSNMTKDWFLVQMLAHYNIGYQGYHLPESYKDRMYSFLRNFEPMCRQLVDVTNY-ATYQSVTVGHQH---.--------NNSGYASPL--STFNPREGHPYPANWPYPLIGVN--AVPTVTQK
HEX_ADE07/621-847 NDTNDQSFNDYLSAANMLYPIPANATNIPISIPSRNWAAFRGWSFTRLKTKETPSLGSGFDPYFVYSGSIPYLDGTFYLNHTFKKVSIMFDSSVSWPGNDRLLSPNEFEIKR--TVDGEGYNVAQCNMTKDWFLVQMLANYNIGYQGFYIPEGYKDRMYSFFRNFQPMSRQVVDEVNYT-DYKAVTLPYQH---.--------NNSGFVGYL--AP-TMRQGEPYPANYPYPLIGTT--AVKSVTQK
HEX_ADE05/635-861 NDTNDQSFNDYLSAANMLYPIPANATNVPISIPSRNWAAFRGWAFTRLKTKETPSLGSGYDPYYTYSGSIPYLDGTFYLNHTFKKVAITFDSSVSWPGNDRLLTPNEFEIKR--SVDGEGYNVAQCNMTKDWFLVQMLANYNIGYQGFYIPESYKDRMYSFFRNFQPMSRQVVDDTKYK-DYQQVGILHQH---.--------NNSGFVGYL--AP-TMREGQAYPANFPYPLIGKT--AVDSITQK
O40957_ADEE2/586-813 NDTNDQSFIDYLSAANMLYTIPAGATQVPISIPSRNWAAFRGWSFTRIKAKETPALGSPFEPYFNYSGTIPYLDGTFYLSHTFRRVSVQFDSSALGPETTVFFTPNEFEIKR--LIDGEGYNVSQSNMTKDWFLVQMLAHYNIGYQGYHLPESYKDRWYGPLRNFQPLCRQVPDPLRFT-DYKAVSVLNQH---.--------NNSGFTGYN--SAGLMREGQPYPANWPYPLIGKN--AVASVTER
HEX_ADEM1/592-819 NETNDQTFLDYLSSATMMFPIPAGQTQVPVSIPARNWAAFRGWSFTRIKQQETPNIGSPYDPYFKYSGSIPFLDATFYLTHTFQRVSIMFDSSVSWPGNDRLLTPNEFEIKR--HIDAEGLCVGQSNMTKDWFLVQMLSNYNIGYQGFYLPENNKDRTYSFVRNFEPLARQVVDDAAAA-NYRDVPLSKRF---.--------NNSGWRSAG--PPIFAREGAPYPANWPYPLCGEA--AWAAKTQR
HEX_ADEB3/598-821 NDTNDQSFNDYLSAANMLYPIPPNATQLP--IPSRNWAAFRGWSLTRLKQRETPALGSPFDPYFTYSGTIPYLDGTFYLSHTFRKVAIQFDSSVTWPGNDRLLTPNEFEIKI--SVDGEGYNVAQSNMTKDWFLVQMLANYNIGYQGYHLPPDYKDRTFSFLHNFIPMCRQVPNPATE--GYFGLGIVNHR---.--------TTPAYWFR---FCRAPREGHPYPQLALPPHWDPR--HALRDPER
Q66853_ADEGX/600-846 NATNDQTFVDYLGAKNALYSVPAGSTALTINIPARTWEGMRGWSFTRIKAAETPQLGAQYDVNFKYSGSMRYSDGGFYLSHTFRNMSILFDTSINWPGNDRLLTPNMFEIKRSVALDTEGFTMSQCDITKDWYLIQMATNYNFVYNGYRFWPDRQYFQYDFLRNFDPMTRQGPNFALPGLFDLVSYTPTTDNSGeQPSQEAVRNNSGFIAPRSWPVWSAHQGESWPANWPYPLCGQQAIQPGQVLSY
HEX_ADEG1/606-852 NATNDQTFADYLGAKNALYNVPAGSTLLTINIPARTWEGMRGWSFTRLKASETPQLGAQYDVGFKYSGSIPYSDGTFYLSHTFRSMSVLFDTSINWPGNDRLLTPNLFEIKRPVATDSEGFTMSQCDMTKDWFLVQMATNYNYVYNGYRFWPDRHYFHYDFLRNFDPMSRQGPNFLDTTLYDLVSSTPVVNDTGsQPSQDNVRNNSGFIAPRSWPVWTAQQGEAWPANWPYPLIGNDAISSNQTVNY
Q9YUR1_9ADEN/588-815 NDQNDQTFMDYMGAKNNLYLVPANQTNVQIEIPSRAWTAFRGWSFNRIKTAETPAVWSTYDLNFKYSGSIPYLDGTFYLSHTFNSMSILFDSAITWPGNDRMLVPNFFEIKR--EIDTEGYTTSQSNMTKDWYLIQMSANYNQGYHGYSFPADKVYRQYDFMSNFDSMSVQVPRSGLAFLFN---------EN-.---YNLIVNNSGFLPSRTAPIAGVNEGHPYPANWPAPLIGN---SPDSVVTV