EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03596 alignment
(6 sequences with 195 aa)


Q97PJ0_STRPN/12-204 YISTSIDYLIILIILFAQLSQNKQKWHIYAGQYLGTGLLVGASLVAAYVVN-FVPEEWMVGLLGLIPIYLGIRFAIVGEDAEEEEEEIIERLEQSKANQLFWTVTLLTIAS-GGDNLGIYIPYFASLDWSQTLVALLVFVIGIIIFCEISRVLSSIPLIFETIEKYERIIVPLVFILLGLYIMYENGTIETFLIV
Q53650_STAAU/26-217 YVATGIDYLVILILLFSQVKKG-QVKHIWIGQYIGTAIVIGASLLVAQGVVNLIPQQWVIGLLGLLPLYLGVKIWIKGEE-DEDESSILSLFSSGKFNQLFLTMIFIVLAS-SADDFSIYIPYFTTLSMSEIFIVTIVFLIMVGVLCYVSYRLASFDFISETIEKYERWIVPIVFIGLGIYILFENGTSNALISF
Q45153_BACFI/12-194 KTSEGLK------GNQTENKHI-SPKDIIIGQYLGFTLLVVVSLLGTFGVM-LIPEKWV-GLLGLIPIYLGIMLFIKGE--DEDENAILSSLNSGKYNSVFLSVAFITFAN-GGDNIGIYVPFFSTLTMNQLAVTVITFFIMVAIWCFIGYRLAAFKHVSETLENYGRWIIPIVFIGLGIYIMVENETFSALLSL
Q9CE92_LACLA/15-205 YWATALDLLILLAILYVRFD-KKSHLSITLGQIIGSFALVLVSLFFAVILK-LVPEEWILGLLGLIPLGLGIKYLFFGD--DDDDEELDELLQKRKNKSLLGTVIIISFASCGADNIALFTPFFMTLSANNLLLSIIIFALNILILGLLGKTIAKIPHLHDVLEKYSRWILAFVYIVLGIMVLLESGTVSKILSF
P95773_STALU/16-207 YIAQALDLLVILLMFFARAKTRKEYRDIYIGQYVGSVALIVISLFFAFVLN-YVPEKWILGLLGLIPIYLGIKVAIYGD--SDGEERAKKELNEKGLSKLVGTIAIVTIASCGADNIGLFVPYFVTLSVTNLLITLFVFLILIFFLVFAAQKLANIPEVGEIVEKFGRWIMAVIYIALGLFIIIENDTIQTILGF
Q9JXN6_NEIMB/16-206 YSGTAVDLLIILMLFFAKRKSRKDIINIYLGQFLGSVSLILLSLLFAFVLD-YIPSKEILGLLGLIPILLGIKVLLLGD--SDGEAIAKEGLR-KDNKNLIFLVAMITFASCGADNIGVFVPYFTTLNLANLIVALLTFLVMIYLLVFSAQKLAQVPSVGETLEKYSRWFVAVVYLGLGIYILVENNSFDMLWTV