EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03391 alignment
(11 sequences with 176 aa)


POL2_BRAV/1268-1433 PTLVLPQAFGGDLPLDLWRGPYTFPLGGGTKRLSTSLDIGTSTTTVSGWRTVSFPAAYALFLQGHGGSLVGEVVHTGSAAVSCALHLCISFGGAPPTLEEALVFPGFRLPSGEGKFHIKVQTPYGRLSTLTPDCALYVYLAG--------GPIAVAPMSVPYQFCIHLERLVDD--
POL2_TORVR/1497-1662 PFITLPHIF-NRLDIGYWRGPTEIDLTSTPAPNAYRLLFGLSTVISGNMSTLNANQALLRFFQGSNGTLHGRIKKIGTALTTCSLLLSLRHKDASLTLETAYQRPHYILA--DGQGAFSLPISTPHAATSFLEDMLRLEIFA------IAGPFSPKDNKAKYQFMCYFDHIELV-E
POL2_RRVS/768-936 PTFVWPPKP-TDISLLKEVWGPYRFTLDGTEAKESFAIMPGTAILHGQQIVRTFPRVVAAHFRSWTGKVRMSIQEVSSIFLTGTYMVGVSW-NATADLADIVTRKHWIVKS-NEIFEVDLYCPYGENPTFTGQANGKPFIIVHK----LGGIVGPKDSVGTFGFMIHIHGLTGVYK
COAT_TRSV/179-344 PTMTWPIQL-GDTFAIDRYYEAKEIKLDGSTSMLSISYNFGGPVKHSKKHAISYSRAVMSRNLGWSGTISGSVKSVSSLFCTASFVIFPWECEAPPTLRQVLWGPHQIMHG-DGQFEIAIKTRLHSAAT-TEEGFGRLGILP------LSGPIAPDAHVGSYEFIVHINTWRPD-S
Q88483_9COMO/1003-1166 NPLTYPIKP-GHLEDLDLVLKSGSIAIGTYTMTKVPVSLAMRVDSAAKRQAYSYAAGVLSHFLGVGGDIIFSVHSTASTFVSCSLRVA-LW-GTIPTTEELAQIPHVDVTL-DAKATLQIQSPFFATAN-FGDDGTAFYIAT------LCAPLAPETMETGFQYYIHIHGINAK-A
POL2_BRSV/1007-1170 QPLSYPIEA-RHLTDLNLMLAPKQIAVGTYAMITFPVSLAAKLQSTSGRTAYSYAAGLLSHFLGVGGTIHFVVRTTSSAFVTSKLRIA-LW-GTVPETDQLAQMPHVDVEV-NVDASLQIQSPFFSTAN-FGNSGSAFYVST------LCAPMAPETVETGSEYYIQIKGIEAN-P
POL2_GCMV/981-1144 SIVTYPISL-EHLKDIEIMLPPRQMAIGNAGSINFPLSFAVQQKSSSGRIAYSYAAGLLSHFLGIGGTIHFKIQCTSSAFVTARLRVA-LW-GDTITLEQLSQMPHVDCDV-DVVSSLKIQSPFYATAN-FGDSGARFWVTP------MSSPMAPETMESKLEYYIQILGIDAD-P
Q65029_ARMV/745-916 PNFIYSADA-FNGSLKFLTIPPLEYDLSATSAYKSVSLLLGQTLVDGTHKVYNFNNTLLSYYLGIGGIVKGKVHVCSPCTYGIVLRVVSEWNGVTNNWNQLFKYPGCYIEE-DGSFAIEIRSPYHRTPLRLIDAQSASSFTSTLNFYAISGPIAPSGETAKMPVVVQIEEIAL--P
POL2_ARMVS/792-963 PNFIYSADA-FNGSLKFLTIPPLEYDLSATSAYKSVSLLLGQTLVDGTHKVYNFNNTLLSYYLGIGGIVKGKVHVCSPCTYGIVLRVVSEWNGVTNNWNQLFKYPGCYIEE-DGSFAIEIRSPYHRTPLRLIDAQSASSFTSTLNFYAISGPIAPSGETAKMPVVVQIEEIAL--P
Q67703_GFLV/166-336 PTLVFDPGV-FNGKFQFLTCPPIFFDLTAVTALKSAGLTLGQVPMVGTTRVYNLNSTLVSCVLGMGGTIRGKVHICAPIFYSIVLWVVSEWNGTTMDWNELFKYPGVYVEE-DGSSEVKIRSPYHRTPARLLAGQSQRDMSS-LNFYAIAGPIAPSGETARLPIVVQIEEIVR--P
POL2_GFLV/771-941 PTLVFDPGV-FNGKFQFLTCPPIFFDLTAVTALRSAGLTLGQVPMVGTTKVYNLNSTLVSCVLGMGGTVRGRVHICAPIFYSIVLWVVSEWNGTTMDWNELFKYPGVYVEE-DGSFEVKIRSPYHRTPARLLAGQSQRDMSS-LNFYAIAGPIAPSGETAQLPIVVQIDEIVR--P