EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03174 alignment
(5 sequences with 67 aa)


Q9ZH38_9GAMM/795-859 LDVPGGEVNKGTLTTSVATAYLDVEYSVDQGKSWQTYQQPVN-VGDTQVWLRSSLNDQ-VKSRITTI
CHB_VIBHA/817-882 LPVPGAKVEDGKLAMNVQFPGVTLQYSLDG-ENWLTYADNARPNVTGEVFIRSVSATGEKVSRITSV
CHB_SERMA/819-885 LPVPGARVAAGKLEANIALPGLGIEYSTDGGKQWQRYDAKAKPAVSGEVQVRSVSPDGKRYSRAEKV
HEX_VIBVU/780-844 LPVLGAVIKNNILDVVTEFHGVAIQYSLDG-KTWHKYDDTKKPQVSTKALVRSVSTNG-RTGRAVEV
Q9R6Y9_ALTSO/848-913 IPLPGGAIEGGKLIVNTRFVGMATEYSVDQGVTWHRYEGPVTLTASSKVQLRTVSDSG-KVSRVATV