EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF03120 alignment
(25 sequences with 88 aa)


YICF_ECOLI/310-394 QVAEVKAIQFAVGKSGK.ISVVASLAPVMLDDKKVQRVNIGSVRRWQEWDIAPGDQILVSLAGQGIPRIDDVVWR..GAERTKPTPPE
DNLJ_TREPA/302-381 AITTLRDVQWQT--SGVtYTPIGITDPVRLAGTTVKRANLCNPNMLTKLCLKIGSHVLISKRGEIIPKIEALVS-..-T--PAHAQEI
DNLJ_BORBU/314-393 ---RVNSIVVQVGRSGK.ITPVANIDKVFVSGAFITSATLHNQDYIRSIGLNVGDVVKVSRRGDVIPAVEMVIN-..-KFSTGFFKVP
DNLJ_HELPJ/312-394 KHTKIVGVINQVGRSGA.ITPVALLEPVEIAGAMVNRATLHNYSEIEKKNIMLNDRVVVIRSGDVIPKIIKPLE-..-SYRDGSQQKI
DNLJ_HAEIN/330-412 ELTLLNDVEFQVGRTGA.ITPVAKLEPVFVAGVTVSNATLHNGDEIERLNIAIGDTVVIRRAGDVIPQIIGVLH-..-ERRPDNAKPI
Q9RBF2_ALTHA/320-402 EITQLLDVDFQVGRTGA.ITPVARLKPVFVGGVTVSNATLHNSDEVARLGVKVGDTVIIRRAGDVIPQITQVVL-..-ERRPDDARDI
DNLJ_ECOLI/320-402 QMTFVRDVEFQVGRTGA.ITPVARLEPVHVAGVLVSNATLHNADEIERLGLRIGDKVVIRRAGDVIPQVVNVVL-..-SERPEDTREV
DNLJ_ZYMMO/348-430 AQTTLLDIEIQVGRTGV.LTPVAKLEPVTVGGVVVSSATLHNSDEIERLGVRPGDRVLVQRAGDVIPQIVENLT-..-PDVDRPIWHF
DNLJ_RICPR/326-407 -QTKLLSITVQVGRTGM.LTPVAELDPIEIGGVVVSRATLHNFQDIARKDVRIKDYVFLQRAGDVIPQITGVDI-..-SKRSNDTVKF
DNLJ_CHLTR/315-397 AETILEDIVVQVGKTGI.LTPVAELAPVFLSGSRVSRASLYNQDEIEKKDIRIGDSVYVEKGGEVIPKIVGINL-..-AKRSLESEPW
DNLJ_CHLPN/316-398 AETLLEDILVQVGRTGV.LTPVAKLTPVLLSGSLVSRASLYNEDEIHRKDIRIGDTVCVAKGGEVIPKVVRVCR-..-EKRPEGSEVW
DNLJ_THEMA/321-403 ARTRVLDVTIQVGRTGV.LTPVAELEPVQLAGTIVKRASLHNFEYIREKDIRIGDYVFVEKAGGIIPQIVKSIP-..-ELRTGNEKEI
DNLJ_RHOMR/362-444 AITRLLDIMVSVGRTGV.VKPVAVLEPVEVGGVTVSQATLHNEDYVRSRDIRIGDLVVVIRAGDVIPQVVRPVV-..-EARTGNERPW
DNLJ_AQUAE/350-432 AVTKLVDVVFQVGRTGT.ITPVGKLEPVELGGVTVSSVSLFNEDFIREKDIRIGDWVVVERAGDVIPYVVEVLK-..-EKRTGEEKPV
Q9ZFY2_9DEIN/236-318 KETRLLDVVFQVGRTGR.VTPVGILEPVLIEGSEVSRVTLHNESYIEELDIRIGDWVLVHKAGGVIPEVLRVLK-..-ERRTGAERPI
DNLJ_STRCO/335-417 VNTKLVDIKVGVGRTGR.VTPYAQVEPVTVAGSEVEFATLHNQEVVKAKGVLIGDTVVLRKAGDVIPEILGPVA-..-DLRDGSEREF
DNLJ_MYCTU/330-412 AQTKLLDIRVNVGRTGR.ITPFAFMTPVKVAGSTVGQATLHNASEIKRKGVLIGDTVVIRKAGDVIPEVLGPVV-..-ELRDGSEREF
DNLJ_BACSU/316-398 VVTKLLDIELNVGRTGV.ITPTAILEPVKVAGTTVSRASLHNEDLIKEKDIRILDKVVVKKAGDIIPEVVNVLV-..-DQRTGEEKEF
DNLJ_BACST/315-397 VVTTLIGIEVNVGRTGV.VTPTAILEPVRVAGTTVQRATLHNEDFIREKDIRIGDAVIIKKAGDIIPEVVGVVV-..-DRRDGDETPF
DNLJ_SYNY3/319-401 TPTVVKAIEVNVGRTGA.VTPLAVMEPVQLAGTTVQRATLHNQDRIQELDIRVGDTVIIRKAGEIIPEVVRVMT-..-ELRPENTTPY
Q99540_HUMAN/327-409 ALTVVRDIEWTVGRTGA.VTPTAIMDPVQLAGTTVQRASLHNPDYLQQKDIRIGDTVTLHKAGDIIPEVGQVIL-..-SQRPADSIAY
Q9RSQ5_DEIRA/330-412 VETVLESITVNVGRTGK.LAPLAHLSPRLIEGSTVSKATLHNEDYIRDMDLRVGDTVLVRKSGGVIPQIMRVLP-..-DKRPADAAPF
DNLJ_MYCGE/310-392 VQTKLTAVLITIGRTGR.VNYTAKLESVNLDGTKVTAATLHNFDYIKTKDIRINDTVVIYKAGEIIPKVLKVNL-..-EKRKNDTIII
DNLJ_MYCPN/309-391 VQTKLRGVLVTVGRTGK.INYTAQLDPVNLEGTVVSAATLHNFDYIKEKDIRLNDTVIIYKAGEIIPKVLEVCL-..-PLRTAANQPI
Q9YVT0_MSEPV/286-370 --TKVLNVIWQISKQNK.YIPIAELEPIKLENKTIKRVSCYNAKFVTENGIGTDAIVEIEYRGGAIPKLVNVIKPvtVDESDLPDGKI