EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02941 alignment
(3 sequences with 77 aa)


FTRV_SPIOL/95-168 VGCKVKVKSPLKVYHVP--KLPEVELTPDMVGVIKQYVGFWKGKYISPNYPFKVEYRIDVPDRGS-VKLVVHLKEEE
FTRV_SYNP6/3-69 VGDRVRVKESVVVYHHPDHRNQAFDLKD-AEGEIAAILTEWNGKPISANFPYLVSF--S--NKFR-----AHLRDFE
FTRV_SYNY3/3-69 VGDRVRVTSSVVVYHHPEHKKTAFDLQG-MEGEVAAVLTEWQGRPISANLPVLVKF--E--QRFK-----AHFRPDE