EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02709 alignment
(9 sequences with 330 aa)


SQV3_CAEEL/1-279 MKLKTR-LILSGTILISLAACYFLVLLVLDLEITRDLMTDYVDPRPLQTSYHKLCVIVPYRDRLEELREFSPHMSKFLHNQNVSHHILIINQTDPLRFNRASLINVGWNEADRLGC.-DYMVMNDVDLLPVNPEVPYDFPGI-GVIRHITSPQYHPKYHYEKFIGGILMLTLKDYKKLNGMSNKYWGWGLEDDEFYLRIIDSKLNLTRVSGLSTDSSNTFRHIHG------PKRKRD-----------------------------------------YTPKKNDKNQWEIKRKRDHVSGLHDVRYLIDSRQLLDFSGTSVTIINVALHC
Q92074_CHICK/93-361 CPDPSP--LLVGPLRVEFSQP--VNLEEVASTNPEVREGGRFAPKDCKA-LQKVAIIIPFRNREEHLKYWLYYMHPILQRQQLDYGVYVINQDGDEEFNRAKLLNVGFTEALKEYD.YDCFVFSDVDLIPMDDRNTYKCYSQ-PRHLSVSMDKFGFRLPYNQYFGGVSALSKEQFTKINGFPNNYWGWGGEDDDIYNRLVFKGMGISRPD-AVIGKCRMIRHS--------RDRKNE-------------------------------------------PNPERFDRIAHTRETMSSDGLNSLSYE-VLRTDRFPLYTRITVDIG-APG
B4GT2_HUMAN/97-366 CPDSPP--GLVGRLLIEFTSP--MPLERVQRENPGVLMGGRYTPPDCTP-AQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDAaYDCFIFSDVDLVPMDDRNLYRCGDQ-PRHFAIAMDKFGFRLPYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPD-IRIGRYRMIKHD--------RDKHNE-------------------------------------------PNPQRFTKIQNTKLTMKRDGIGSVRYQ-VLEVSRQPLFTNITVDIG-RPP
B4GT4_HUMAN/77-344 CPSVSP--YLRGQSKLIFKPD--LTLEEVQAENPKVSRG-RYRPQECKA-LQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEEN.WDCFIFHDVDLVPENDFNLYKCEEH-PKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPL-PEVGKYTMVFHT--------RDKGNE-------------------------------------------VNAERMKLLHQVSRVWRTDGLSSCSYK-LVSVEHNPLYINITVDFW-FGA
B4GT3_HUMAN/77-346 CPERSP--LLVGPVSVSFSPV--PSLAEIVERNPRVEPGARYRPAGCEP-RSRTAIIVPHRAREHHLRLLLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNVGVREALRDEE.WDCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNSFGYSLPYPQYFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPP-TSVGHYKMVKHR--------GDKGNE-------------------------------------------ENPHRFDLLVRTQNSWTQDGMNSLTYQ-LLARELGPLYTNITADIG-TDP
B4GT5_HUMAN/114-381 CPERLP--SMKGPIDINMSEIGMDYIHELFSKDPTIKLGGHWKPSDCMP-RWKVAILIPFRNRHEHLPVLFRHLLPMLQRQRLQFAFYVVEQVGTQPFNRAMLFNVGFQEAMKDLD.WDCLIFHDVDHIPESDRNYYGCGQM-PRHFATKLDKYMYLLPYTEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVQNAGYSVSRPE-GDTGKYKSIPH---------HHRGEV-------------------------------------------QFLGRYALLRKSKERQGLDGLNNLNY--FANITYDALYKNITVNL--TPE
B4GT6_HUMAN/108-375 CPEKLP--YMRGFLNVNVSEVSFDEIHQLFSKDLDIEPGGHWRPKDCKP-RWKVAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDSV.WDCVIFHDVDHLPENDRNYYGCGEM-PRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVHYAGYNVTRPE-GDLGKYKSIPH---------HHRGEV-------------------------------------------QFLGRYKLLRYSKERQYIDGLNNLIYR--PKILVDRLYTNISVNL--MPE
BAGT_LYMST/143-462 CPIRPP--ALAGRFVPSKKSS---TYHELAAMFPDVQDGGHYTPRMCTP-AEKTAIIIPYRNRCRHLYTLLPNLIPMLMRQNVDFTIFVIEQTTPETFNKGILFNAGYLEALKVDN.YDCFILHDVDMIPIDDRNMYRCNKMGPVHFSPGVNKFKYKLFYSGLFGGVVGFTREQFRLINGASNLYFGWGGEDDDLRNRAVHMKLPLLRKT-LAHGLYDMVSHVEAGWNVNPHSKGAHSLYDMLNKALGVQAGWNVHPNSKWPLRLFDSVNHAPAEGAGWNVNPDRFKIYSTSRQRQHVDGINSLVYN-VTWYRTSPLYTWVGVGFN-KTV
Q21608_CAEEL/109-381 CPIVEKIPDLQGALPQATLLIQNLQEGEVHAIHPELGPGGSWKPDDCQA-RDKIAVIIPYRERQTHLTRLIDFLIPILQRQRLDFRFIVTEQYGNDLFNKGRIMNAAFIFAESLGV.-DCVVFHDVDMFPQDDRNPYSCPPG-PRHLGAFVSNLGYQLWYKEIVGGVLAVSMADYRAVNGYSNQFWAWGGEDDDMGQRILSLNYTIERPN-PETGRYSMLKHVK-------RKRTAP-------------------------------------------KLIYKLLGN--SANRVAYDGLNETDKWTIRKVTTRPLYYHLYVDVGPVPE