EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02494 alignment
(15 sequences with 87 aa)


Q20535_CAEEL/1196-1277 PDTQPPVM-KCPDS.--YTIPVGNSTKHVIFDMTTVDMVLHDTSNVSDVTFTPSEATLKIGEFEEVTAQAEDENGNRN-SCKFQVAY
Q20535_CAEEL/1111-1195 VDMEPPKFENCPESeIFAKVDENGQLKAVEFEEPAASDNSGKIAYTQIEPLGMRTGLMITE-DMDVTYTAFDSAGNTA-VCVLKIRI
P90891_CAEEL/2293-2373 KDRLPPTVLRCPKN.IRKGTTEDFTKVEWPDEDVAFFDNIG---VIRIEVNYHNGQQFGVG-ITTVRYVGFDAAGNSA-ECTFDVTI
HYAL_STRPU/882-964 VDTMMPMFTSCPNN.IVQSVELGVPGTVISWTTPTANDAAG---IASIVSNLQPGSFFTVGESATVTYVATDNSGLTDNSCSFTVTV
HYAL_STRPU/798-879 VDTTPPTV-NCANN.IAQTIELGSTSAVVNYAEPSATDISG--TAFLVSRSSSPGDSFPIG-STTVTYIFSDQSGNEAPPCVFTVTI
HYAL_STRPU/1051-1131 QDTTPPTV-NCITN.IVRTVELGTSSVQVFYNEPTASDL-G--QASLVSRTAQPGDNFPVG-VNPVTYVFGDNSGNQADPCTFTITV
HYAL_STRPU/967-1048 VDTTPPSV-VCTNN.VFQTVELGTNPVQVFYTEPTASDISG--QANLVSRTNVPGDSFPVG-TSTVTYVFADNSGNTADACSFTITV
HYAL_STRPU/714-795 VDTTPPTV-NCINN.VAQTVQLGTGSTQVFFTEPTAFDISG--QTSLVTRTSAPGDSFPVG-TTSVTYIFTDASGNNAQPCTFNVVI
HYAL_STRPU/630-711 VDTTPPSV-NCPNN.VFQEVELGTSSAPVFFTEPTAFDISG--QANLVTRTAAPGDSFPVG-TTSVSYIFSDNSGNEAEPCTFTVTI
HYAL_STRPU/546-627 VDTTPPTV-TVSGGnIVRTVELGQSRLSVIYTEPTATDNSG--EANLVSRTAQPGDLFPVG-TTTVEYVYQDPAGNEG-RGQFTVTV
HYAL_STRPU/461-542 VDTTPPQV-FVTTGeVVRTAPFGSSGVNVFFTEPVAIDNSG--TADLVSQTAQPGDFFPIG-STVVTYRYRDASGNEA-TGTFTVTV
HYAL_STRPU/40-121 TDTTPPVV-TVSSStITRQVEVGTPGVNVFFTEPTATDNSG--QAILISRTNQPGDFFSVG-QTIVTYTFQDPSGNPA-SGTVTINV
SRPX_HUMAN/175-257 VDMEPPRI-KCPSV.KERIAEPNKLTVRVSWETPEGRDTADGILTDVILKGLPPGSNFPEG-DHKIQYTVYDRAENKG-TCKFRVKV
O60687_HUMAN/177-259 VDIDPPKI-RCPHS.REKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEG-EHVIRYTAYDRAYNRA-SCKFIVKV
P91526_CAEEL/629-701 IEDCPSDM------.---VISSMDRETNVTWPEPTFLSSNS--KIEKIEKNLKQGQMFTWG-EYDVLYTATDNATNQA-QCNFKIRV