EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02315 alignment
(3 sequences with 95 aa)


O24762_HYPME/6-100 LPIVAGAMLVAAGFVGMTTPAAMAYDGTKCKAPGNCWEPKPGFPEKIAGSKYDPKHNPKELAKQVESRKGEEARNAQRAAHFKKTGKWVYDVKKI
DHM2_METEX/1-93 MKTTLIAAAIVALSG--LAAPALAYDGTKCKAAGNCWEPKPGFPEKIAGSKYDPKHDPKELNKQADSIKQMEERNKKRVENFKKTGKFEYDVAKI
DHM2_PARDE/1-91 MKRILTLTVAALALG----TPALAYDGTNCKAPGNCWEPKPDYPAKVEGSKYDPQHDPAELSKQGESLAVMDARNEWRVWNMKKTGKFEYDVKKI