EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02247 alignment
(8 sequences with 381 aa)


Q9YWJ9_9COMO/452-824 NELDLAQLSLDDTSSLRGTALQTKLATSRIILSKTMVGNTVLREDLLATFLQDSNERAAIDLIRTHVIRGKIRCVASINVPENTGCALAICFNSGITGA-ADTDIYTTSSQDAIVWNPACEKAVELTFNPNPCGDAWNFVFLQQTKAH--FAVQCVTGWTTTPLTDLALVLTWHIDRSLCVPKTLTISSAHASFPINRWMGKLSFPQGPARVLKRMPLAIGGGAGTKDAILMNMPNAVISLHRYFRGDFVFEITKMSSPYIKATIAFFIAFGDITEEMTN---LESFPHKLVQFAEIQGRT-TITFTQSEFLTAWSTQVLSTVDPQKDGCPHLYALLH-DSATSTIEGNFVIGVKLLDIRNYRAYGHNPGFEGARLLGISG
Q9YWK0_9COMO/363-735 NELDLAQLSLDDTSSLRGSVLQTKLATSRVILSKTMVGNTILRENLLATFLQDSNERAAIDLIRTHVIRGKIRCVASINVPENTGCALAICFNSGITGA-ADTDIYTTSSQDAIVWNPACEKAVELSFNPNPCSDAWNFVFLQKTKAH--FAVQCVTGWTTTPLTDLALVLTWHIDRNLCVPETLTISSAHASFPINRWMGKLSFPQGPARVLKRMPLAIGGGAGTKDAILMNMPNAVISLHRYFRGDFVFEITKMSSPYIKATIAFFIAFGDITEEMTN---LESFPHKLVQFAEIQGRT-TITFTQGEFLTAWSTQVLSTVNPQKDGCPHLYALLH-DSATSTIEGNFIIGVKLLDIRNYRAYGHNPGFEGARLLGISG
VGNM_RCMV/407-778 TDTDLFKLSLDDTSSPKGSLLDTRFAQKKVLIPKAMAGGADLLSSNLYDVLSGSSFRASLALARTHVVEGKIRCICTINLPENTGCCLAITVNSSNRGQ-FSTDIYTTGSQDRILWNPACSKNCDFSFNPNPCGTAWSLEFLRRTKFH--LSVTCVSGWSAQPQTDIAMTMDWYVSNKPCVPCIYNVGTPGQNVWVNRWMGKLSFPQGSQNQLKQMPLAIGGGAGAKNSILMNMTNAFLSLWRYFHGDLVFEVQKMSSPFIKSTVTFFIGFGGLPFSEN----LEDFPNKLIQFGEVQERV-EITFTRKEFLTAWSTQVDPAGPVAGDGCPYLCAMVH-DSTASTITGDFNLGVTLLRIENFVGIGRNPGIQGARLLGSMQ
VGNM_BPMV/447-819 METNLFKLSLDDVETPKGSMLDLKISQSKIALPKNTVGGTILRSDLLANFLTEGNFRASVDLQRTHRIKGMIKMVATVGIPENTGIALACAMNSSIRGR-ASSDIYTICSQDCELWNPACTKAMTMSFNPNPCSDAWSLEFLKRTGFH--CDIICVTGWTATPMQDVQVTIDWFISSQECVPRTYCVLNPQNPFVLNRWMGKLTFPQGTSRSVKRMPLSIGGGAGAKSAILMNMPNAVLSMWRYFVGDLVFEVSKMTSPYIKCTVSFFIAFGNLADDTIN---FEAFPHKLVQFGEIQEKV-VLKFSQEEFLTAWSTQVRPATTLLADGCPYLYAMVH-DSSVSTIPGDFVIGVKLTIIENMCAYGLNPGISGSRLLGTIP
Q66170_CPMV/343-715 MEQNLFALSLDDTSSVRGSLLDTKFAQTRVLLSKAMAGGDVLLDEYLYDVVNGQDFRATVAFLRTHVITGKIKVTATTNISDNSGCCLMLAINSGVRGK-YSTDVYTICSQDSMTWNPGCKKNFSFTFNPNPCGDSWSAEMISRSRVR--MTVICVSGWTLSPTTDVIAKLDWSIVNEKCEPTIYHLADCQNWLPLNRWMGKLTFPQGVTSEVRRMPLSIGGGAGATQAFLANMPNSWISMWRYFRGELHFEVTKMSSPYIKATVTFLIAFGNLSDAFGF---YESFPHRIVQFAEVEEKC-TLVFSQQEFVTAWSTQVNPRTTLEADGCPYLYAIIH-DSTTGTISGDFNLGVKLVGIKDFCGIGSNPGIDGSRLLGAIA
VGNM_CPMV/460-832 MEQNLFALSLDDTSSVRGSLLDTKFAQTRVLLSKAMAGGDVLLDEYLYDVVNGQDFRATVAFLRTHVITGKIKVTATTNISDNSGCCLMLAINSGVRGK-YSTDVYTICSQDSMTWNPGCKKNFSFTFNPNPCGDSWSAEMISRSRVR--MTVICVSGWTLSPTTDVIAKLDWSIVNEKCEPTIYHLADCQNWLPLNRWMGKLTFPQGVTSEVRRMPLSIGGGAGATQAFLANMPNSWISMWRYFRGELHFEVTKMSSPYIKATVTFLIAFGNLSDAFGF---YESFPHRIVQFAEVEEKC-TLVFSQQEFVTAWSTQVNPRTTLEADGCPYLYAIIH-DSTTGTISGDFNLGVKLVGIKDFCGIGSNPGIDGSRLLGAIA
Q9Z006_9COMO/476-846 Q--------TNNFAIESATETMRLLFSGYASIPLNVIPGTKITVAYLN-ELSKHSAVHTGLLNMLSKIPGSLKVKINCQVAPTCGIGLAVSYVEGNESANLGSSLGRLLGIQHYKWNPAIEPYVEFCFQAFFLCRLVEHALFRVFQICSCGGHTDIVQVAERSEVDARISFAIYYEPTITLPKQIATLEHAPAFMFRKELGTLAFKQG-ELVAYSFEVNFGKPQTDGKEVTSTFASAYCGLSQYIQSDVILDFTLMSSPMIGGTFSIAYVAGAYIEKVGNMQILDSLPHIDFTFSSGSKSTRSVRFPKEVFGVYQALDRWDLDSARGDDVSGNFVLYQRDAVSSALEGELTFRIAARLSGDITFTGVSAGYPTTITRIGKG
O12663_9COMO/321-691 Q--------TNNFAIESATETMRLLFSGHASIPLNVIPGTKITVAYLN-ELSKHSAVHTGLLNMLSKIPGSLKVKINCQVAPTCGIGLAVSYVEGNESANLGSSLGRLLGIQHYKWNPAIEPFVEFIFKPFSCADWWNMHYLGSFKCAPVVVIQTLSKWLNSPKVDARISFAIYYEPSIVLPKQIATLEHAPAFMFRKELGTLAFKQG-ERVAYSFEVNFGKPQTDGKEVTSTFASSYCGLSQYMQSDVILDFTLMSSPMIGGTFSIAYVAGAYIEKVGNMQILDSLPHIDFTFSAGSKSTRSVRFPKEIFGVYQALDRWDLDSARGDDVSGNFVLYQRDAVSSALEGELTFRIAARLSGDINFTGVSAGYPTTITRIGKG