EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02035 alignment
(2 sequences with 174 aa)


COAG_LIMPO/23-195 PNVPTCLCEEPTLLGRKVIVSQETKDKIEEAVQAITDKDEISGRGFSIFGGHPAFKECGKYECRTVTSEDSRCYNFFPFHHFPSECPVSVSACEPTFGYTTSNELRIIVQAPKAGFRQCVWQHKCRAYGSNFCQRTGRCTQQRSVVRLVTYDLEKGVFFCENVRTCCGCPCRS-
COAG_TACTR/23-195 TNAPICLCDEPGVLGRTQIVTTEIKDKIEKAVEAVAQESGVSGRGFSIFSHHPVFRECGKYECRTVRPEHSRCYNFPPFTHFKLECPVSTRDCEPVFGYTVAGEFRVIVQAPRAGFRQCVWQHKCR-FGSNSCGYNGRCTQQRSVVRLVTYNLEKDGFLCESFRTCCGCPCRSF