EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF02008 alignment
(14 sequences with 50 aa)


Q9U1S4_CAEEL/137-184 APTFKARVgCNACEDCRMQ-DCQICLVCLDKRFFENRHIPGA-MCAKKRC
Q9W352_DROME/178-218 REPKMGKR.CGTCEGCRRP-NCNQCDACRVRV------GHKP-RCIFRTC
Q9VZX2_DROME/646-686 QSKKKRKR.CGECVGCQRKDNCGECAPCR-------NDKSHQ-ICKQRRC
Q9U1S4_CAEEL/79-125 HRSTTSRR.CGVCRGCQCK-PCGQCTYCQDSPQFGGPGVKKQ-SCIERRC
MBD1_HUMAN/217-262 RIVERSRG.CGVCRGCQTQEDCGHCPICLRPPR---PGLRRQWKCVQRRC
MBD1_MOUSE/348-395 TNQRQNRK.CGACAACLRRMDCGRCDFCCDKPKFGGGNQKRQ-KCRWRQC
MLL4_HUMAN/959-1005 KKMRMAR-.CGHCRGCLRVQDCGSCVNCLDKPKFGGPNTKKQ-CCVYRKC
HRX_HUMAN/1147-1194 KKGRRSRR.CGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQ-CCKMRKC
Q9UF75_HUMAN/477-523 GARRRRTR.CRKCEACLRT-ECGECHFCKDMKKFGGPGRMKQ-SCIMRQC
Q9VHH9_DROME/670-716 QPRRRRTR.CKNCAACQRS-DCGTCPFCMDMVKFGGPGRAKQ-TCMMRQC
DNMT1_PARLI/625-671 AASERKKR.CGVCEICQAP-DCGKCTACKDMIKFGGSGKAKQ-ACKDRRC
P79922_XENLA/518-564 ENGIKRRA.CGVCEVCQQP-DCGQCKACQAMLKFGGAGRTKQ-ACMQRRC
DNMT1_MOUSE/648-694 ENAMKRRR.CGVCEVCQQP-ECGKCKACKDMVKFGGTGRSKQ-ACLKRRC
MBD1_MOUSE/186-233 QRMFKRVG.CGDCAACLVKEDCGVCSTCRLQLPSDVASGLYC-KCERRRC