EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01233 alignment
(6 sequences with 164 aa)


NMT_YEAST/56-217 EGPIDKPKTPEDISDKPLPLLSSFEWCSIDVDNKKQLEDVFVLLNENYVEDRDAGFRFNYTKEFFNWALKSPGWKKDWHIGVRVKETQKLVAFISAIPVTLGVR--GKQVPSVEINFLCVHKQLRSKRLTPVLIKEITRRVNKCDIWHALYTAGIVLPAPVSTC
NMT_CANAL/60-223 EGPIDKLKTPEDVPNDPLPLISDFEWSTLDIDDNLQLDELYKLLYDNYVEDIDATFRFKYSHEFFQWALKPPGWRKDWHVGVRVKSTGKLVAFIAATPVTFKLNKSNKVIDSVEINFLCIHKKLRNKRLAPVLIKEITRRVNKQNIWQALYTGGSILPTPLTTC
NMT_CRYNE/67-228 EGPIDDPKTPADVKQEPGVLPAGFEWSTIDINDEEQSKEVYVLLCENYVEDDDAMFRFNYSREFLLWALTAPGYLPDWHIGVRVQKTKKLVAFISGIKIDIRVR--AKTFPAAEINFLCVHKKLRSKRLAPVLIKEVTRRVNLTNIWQAIYTAGVILPTPIGTC
NMT_AJECA/138-298 DGPI-KIVELDQVSREPIPLVDGFEWVTLDIDDEADVKEFYELLANHYVEDGSAMFRFNYSPAFLNWALKAPGWKREWHVGVRASKSGKLVASICGVPAEIAVR--GKSLKVTEINFLCVHKKLRSKRLTPVLIKEITRRCYLNGIYQAIYTVGIMLPTPVSAC
NMT1_HUMAN/137-294 PVEPDK----DNIRQEPYTLPQGFTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGVRVVSSRKLVGFISAIPANIHIY--DTEKKMVEINFLCVHKKLRSKRVAPVLIREITRRVHLEGIFQAVYTAGVVLPKPVGTC
NMT_CAEEL/86-247 NCAIEENIALDKVRAEPFSLPAGFRWSNVDLSDEEQLNELYNLLTRNYVEDDDSMFRFDYSADFLKWALQVPGFRPEWHCGVRADSNNRLLAFIGAVPQTVRVY--DKTVNMVEINFLCVHKNLRSRRVAPVLIREITRRVNVTGIFQAAFTAGIVIPKPVSVC