EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01157 alignment
(5 sequences with 99 aa)


RL21_METJA/3-97 QMSEGFRRKTRKKLSKHPRERGLYPITRALREFKEGEYVHIVIDPSVHKGMPHPRFHGRTGIVV----GKQGRAFIVKVRDGGKYKQIIAYPQHLRPAT
RL21_HALMA/1-95 PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVE----GKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
RL21_HUMAN/1-99 TNTKGKRRGTRYMFSRPFRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRINVRIEHIKHSK
RL21A_YEAST/2-100 GKSHGYRSRTRYMFQRDFRKHGAVHLSTYLKVYKVGDIVDIKANGSIQKGMPHKFYQGKTGVVYNVTKSSVGVIINKMVGNRYLEKRLNLRVEHIKHSK
RL21_ENTHI/2-100 PLSNGRNRRTRKLFKRPFRGHGLSNTSTILHTYKVGDYVTILCNSSIQHGLPYKAFHGKTGRVWNVNPHAIGVMVNKKVNNRIVVKRLHISPEHIRPSG