EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF01081 alignment
(5 sequences with 196 aa)


ALKH_ZYMMO/1-192 MDSVMRLAPVMPVLVIEDIADAKPIAEALVAGGLNVLEVTLRTPCALEAIK-IMKEVPGAVVGAGTVLNAKMLDQAQEAGCEFFVSPGLTADLGKHAVAQKAALLPGVANAADVMLGLDLGLDRFKFFPAENIGGLPALKSMASVFRQVRFCPTGGITPTSAPKYLENPSILCVGGSWVVPAG---KPDVAKITAL
ALKH_ECOLI/8-203 AESILTTGPVVPVIVVKKLEHAVPMAKALVAGGVRVLEVTLRTECAVDAIRAIAKEVPEAIVGAGTVLNPQQLAEVTEAGAQFAISPGLTEPLLKAATEGTIPLIPGISTVSELMLGMDYGLKEFKFFPAEANGGVKALQAIAGPFSQVRFCPTGGISPANYRDYLALKSVLCIGGSWLVPADALEAGDYDRITKL
ALKD_PSEPU/19-214 IDAICEKARILPVITIAREEDILPLADALAAGGIRTLEVTLRSQHGLKAIQVLREQRPELCVGAGTVLDRSMFAAVEAAGAQFVVTPGITEDILEAGVDSEIPLLPGISTPSEIMMGYALGYRRFKLFPAEISGGVAAIKAFGGPFGDIRFCPTGGVNPANVRNYMALPNVMCVGTGWMLDSSWIKNGDWARIEAC
ALKH_HAEIN/8-203 IIEKLRELKIVPVIALDNADDILPLADTLAKNGLSVAEITFRSEAAADAIRLLRANRPDFLIAAGTVLTAEQVVLAKSSGADFVVTPGLNPKIVKLCQDLNFPITPGVNNPMAIEIALEMGISAVKFFPAEASGGVKMIKALLGPYAQLQIMPTGGIGLHNIRDYLAIPNIVACGGSWFVEKKLIQSNNWDEIGRL
ALKH_BACSU/6-196 VENRLKEAKLIAVIRSKDKQEACQQIESLLDKGIRAVEVTYTTPGASDIIE-SFRNREDILIGAGTVISAQQAGEAAKAGAQFIVSPGFSADLAEHLSFVKTHYIPGVLTPSEIMEALTFGFTTLKLFPSGVFG-IPFMKNLAGPFPQVTFIPTGGIHPSEVPDWLRAGAGAVGVGSQLGSCS---KEDLQAVFQV