EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00915 alignment
(11 sequences with 314 aa)


Q83876_9CALI/2-296 MMASKD--------ATSSVDGASASVQLVPEVNA-SDPLAMDPVAGSSTAVATAGQVNPID---PWIINNFVQAPQGEFTISPNNTPGDVLFDLSLGPHLNPFLLHLSQMYNGWVGNMRVRIMLAGNAFTAGKIIVSCIPPGFGSQQLTIAQATLFPHVIADVRTLDPIEVPLEDVRNVLFHNNDRNQQTMRLVCMLYTPLSTGGGTG--DSFVVAGRVMTCPSPDFNFLFLVPP--TVEQKTRP---FTLPNLPLSSLSNSRAPLPISGMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNG
COAT_SOUV3/2-297 MMASKD--------APQSADGASGAGQLVPEVNT-ADPLPMEPVAGPTTAVATAGQVNMID---PWIVNNFVQSPQGEFTISPNNTPGDILFDLQLGPHLNPFLSHLSQMYNGWVGNMRVRILLAGNAFSAGKIIVCCVPPGFTSSSLTIAQATLFPHVIADVRTLEPIEMPLEDVRNVLYHTND-NQPTMRLVCMLYTPLRTGGGSGNSDSFVVAGRVLTAPSSDFSFLFLVPP--TIEQKTRA---FTVPNIPLQTLSNSRFPSLIQGMILSPDASQVVQFQNGRCLIDGQLLGTTPATSGQLFRVRGKINQ
Q66418_9CALI/2-297 MMASKD--------APTNMDGTSGAGQLVPEANT-AEPISMEPVAGAATAAATAGQVNMID---PWIMSNYVQAPQGEFTISPNNTPGDILFDLQLGPHLNPFLSHLAQMYNGWVGNMRVKVLLAGNAFTAGKIIISCIPPGFAAQNISIAQATMFPHVIADVRVLEPIEVPLEDVRNVLFHNND-SSPTMRLVCMLYTPLRASGSSSGTDPFVIAGRVLTCPSPDFSFLFLVPP--NVEQKTKP---FSVPNLPLNTLSNSRVPSLINAMMISRDHGQMVQFQNGRVTLDGQLQGTTPTSLSQLCKIRGKVFH
Q66296_9CALI/2-292 KMASND--------AAPSNDGAAC---LVPEIN--NEAMALEPVAGSAIAAPLTGQQNIID---PWIMNNFVQAPGGEFTVSPRNSPGEVLLNLELGPEINPYLAHLARMYNGYAGGFEVQVVLAGNAFTAGKIIFAAIPPNFPIDNLSAAQITMCPHVIVDVRQLEPINLPMPDVRNNFFHYNQGSDSRLRLIAMLYTPLRANNSGD--DVFTVSCRVLTRPSPDFSFNFLVPP--TVESKTKP---FTLPILTISEMSNSRFPVPIDSLHTSPTENIVVQCQNGRVTLDGELMGTTQLLPSQICAFRGTLTR
O12305_9CALI/2-292 KMASND--------AAPSTDGAAG---LVPESN--NEVMALEPVAGAALAAPVTGQTNIID---PWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLARMYNGYAGGMEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPDVRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGD--DVFTVSCRVLTRPSPDFDFTYLVPP--TVESKTKP---FTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTTQLQVSGICAFKGEVTA
COAT_LORDV/2-292 KMASND--------ANPSDGSAAN---LVPEVN--NEVMALEPVVGAAIAAPVAGQQNVID---PWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLSRMYNGYAGGFEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPDVRNNFYHYNQANDSTLKLIAMLYTPLRANNAGD--DVFTVSCRVLTRPSPDFDFIFLVPP--TVESRTKP---FTVPVLTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTTQLSAVNICNFRGDVTH
POLN_RHDV/1768-2066 GKARAAPQGEAAGTATTASVPGTTTDGMDPGVVATTSVITAENSSASIATAGIGGPPQQVDQQETWRTNFYYNDVFTWSVADAP---GSILYTVQHSPQNNPFTAVLSQMYAGWAGGMQFRFIVAGSGVFGGRLVRAVIPP--GIEIGPGLEVRQFPHVVIDARSLEPVTITMPDLRPNMYHPTGDPGLVPTLVLSVYNNLINPFGGS---TSAIQVTVETRPSEDFEFVMIRAPSSKTVDSISPAGLLTTPVLTGVGNDN-RWNGQIVGLQPVP---GGFSTCNRHWNLNGSTYG---WSSPRFGDIDHRRGS
O09725_9CALI/267-561 GNGSKLPTNQNGGHVGQDVDPPGATGPTTSHVVVSNPEQPNGPAQRLEMAVATGSIQSNVPE--AVRNCFAVCRTFAWNDRMPT---GTFLGSLSLHPNINPYTSHLSGMWAGWGGSFEARISISGSGMFAGRIIASVIPP--GVDPTSIRDPGVLPHAFVDARVTDPVSFMIPDVRNIDYHRMDITEPTCSLGFWVYQPLLNPFSTT--AVTTCWVSIETKPGGDFDFCLLRPPGQQMENGVSPE--GLLPRRLGYTRGN-RVGGLIVGMVLVAD---HRQ-VNRHFNARSITYG---WSTAPVNPMAAAIQT
COAT_SMSV1/137-427 LQSTVD-TKPDF-VFRAESDGPGGADIVTEEQGT-VVQQQPVPAQSALTTLAAASTGKTVDC--EWTTFFSYHTAVNWSTTEAQ---GKILFSRALSPELNPYLRHISSLYSTWSGGIDVRFTVSGSGVFGGKLAALIVPP--GIEPVESPTMLQYPHVLFDARQTEPVIFTIPDIRKTLYHSMD-DTDTTRLVIMVYNELINP-YEQSEPKSSCSITVETRPSSDFTFSLLKPPGSLLKHGSIPS--DLIPRNSRHWMGN-RWWSTIDGFVVQP---RVFQ-SNRHFDFDSTTTG---WSTPYYIPIEVTLE-
P89681_9CALI/137-422 LRSTAD-VNSNF-TFRAESDGPGSTEIVTEEQGT-IVQQQPAPAPTALATLATASTGKSVEQ--EWMTFFSYHTSINWSTVESQ---GKVLYSQALNPSINPYLDHISKLYSTWSGGIDVRFTVSGSGVFGGKLAALLVPP--GVEPIESVSMLQYPHVLFDARQTEPVIFTIPDIRKTLFHSMD-ETDTTKLVIMVY----KNGADT---KTTCSITVETRPSADFTFALLKPPGSLIKHGSIPS--DLIPRNSAHWLGN-RWWSMISGFSVQP---RVFQ-SNRHFDFDSTTTG---WSTPYYIPIEITITA
COAT_FCVC6/107-396 ICKVAEGWDPNLPLFRLEAD---DGSITTPEQGT-MVGGVIAEPNAQMSTAADMATGKSVDS--EWEAFFSFHTSVNWSTSETQ---GKILFKQSLGPLLNPYLTHLAKLYVAWSGSVDVRFSISGSGVFGGKLAAIVVPP--GIDPVQSTSMLQYPHVLFDARQVEPVIFSIPDLRSTLYHLMS-DTDTTSLVIMVYNDLINP-YANDSNSSGCIVTVETKPGPDFKFHLLKPPGSMLTHGSIPS--DLIPKSSSLWIGN-RFWSDITDFVIRP---FVFQ-ANRHFDFNQETAG---WSTPRFRPITITIS-