EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00799 alignment
(13 sequences with 294 aa)


VAL1_WDV/9-264 FRVYSKYLFLTYPECTLEPQYALDSLRTLLNKYEPL.YIAAVRELHEDGSPHLHVLVQNKLRASITNPNALNLRMDTSpFSIFHPNIQAAKDCNQVRDYITKEVDsDVNTAEWGTFVAVS--------TPGR------K-DRDADMKQIIESSSSR---EE---FLSMVCNRFPFEWSIRLKDFEYTARHLFPDPVATYTPEF---PTES---LICHETIE--SWKNEHLYSVSLES--YILCTSTPADQAQS---DLEWMDDYSRSHR--.GGISPSTSAGQPEQERLPGQGL
VAL1_TYDVA/11-257 FRLQTKYVFLTYPRCSSSAENLRDFLWDKLSRFAIF.FIAIATELHQDGTPHLHCLIQLDKRSNIRDPSFFDLEG---.---NHPNIQPAKNSEQVLEYISKDG-.--NVITKGEFKKHR-------VSPSK---------SDERWRTIIQTATSK---EE---YLDMIKDEFPHEWATKLQWLEYSANKLFPPQPEIYQATF----TEED--LQCHEDLQ--LWRDQHLYHVSVDAYR--LVHNVTLVEAHS---DLVWMDDISRNLEGLePGSPPSTSADQVVPERQHGPEA
VAL1_PASVK/17-277 FRHRNANTFLTYSKCPLEPEFIGEHLFRLTREYEPA.YILVVRETHTDGTWHCHALLQCIKPCTTRDERYFDIDR---.---YHGNIQSAKSTDKVREYILKDPK.--DKWEKGTYIPRK----KSFVPPGK-EPAEKKPTKDEVMREIMTHATSR---EE---YLSLVQSSLPYDWATKLNYFEYSASRLFPDIAEPYTNPH--PTTEYD--LHCNETIE--DWLKPNIYQVSPQAYKLLEPSCLSLEQAIA---DLEWLDDTT-RMLQE.KEREASTSAAQHGQVKHPGLEA
VAL1_MSVK/10-272 FSHRNANTFLTYPKCPENPEIACQMIWELVVRWIPK.YILCAREAHKDGSLHLHALLQTEKPVRISDSRFFDING---.---FHPNIQSAKSVNRVRDYILKEPL.--AVFERGTFIPRK----SPFLGKSDSEVKEKKPSKDEIMRDIISHSTSK---EE---YLSMIQKELPFDWSTKLQYFEYSANKLFPEIQEEFTNPH--PPSSPD--LLCNESIN--DWLQPNIFQVSPEAYMLLQPACYTLDDAIS---DLQWMDSVSSHQMKD.QESRASTSSAQQEQENLLGPEA
VAL1_CSMV/34-285 FSLRTKHVFLTYPRCPISPEEAGQKIADRLKNKKCN.YIYISREFHADGEPHLHAFVQLEANFRTTSPKYFDLDE---.---FHPNIQAARQPASTLKYCMKHPE.--SSWEFGKFLKPK---------VNR--SPTQSASRDKTMKQIMANATSRD---E---YLSMVRKSFPFEWAVRLQQFQYSANALFPDPPQTYSAPY----ASRD--MSDHPVIG--EWLQQELYTVSPQA---LSLHAGISEEQAR--IDLQWMSDLTRSGALE.SGDEACTSVGQQELERLLGPEV
VAL1_TYLCA/7-290 FRINAKNYFLTYPKCSLTKEEALSQLNNLETPTSKK.YIKVCRELHENGEPHLHVLIQFEGKFQCKNQRFFDLVSPTR.SAHFHPNIQGAKSSSDVKSYLEKDG-.--DTLEWGEFQIDGRSARGGQQSANDAYAQALNTGSKSEALNVLRELAPKDYVLQFHNLNSNLDRIFTPPLEVYVSPFLSSSFDRVPEELEEWVAEN-VKDAAARPLRPISIVIEGESRTGKTVWARSLGPHNYLCGHLDLSPKVYSNDAWYNVIDDVDPHYL--.KHFKEFMGAQRDWQSNTKYGKP
VAL1_CLVK/6-289 FRIQAKNVFLTYPKCSIPKEHLLSFIQTLSLQSNPK.FIKICRELHQNGEPHLHALIQFEGKITITNNRLFDCVHPSC.STSFHPNIQGAKSSSDVKSYLDKDG-.--DTVEWGQFQIDGRSARGGQQSANDAYAKALNSGSKSEALNVIRELVPKDFVLQFHNLNSNLDRIFQEPPAPYVSPFPCSSFDQVPVEIEEWVADN-VRDSAARPWRPNSIVIEGDSRTGKTIWARSLGPHNYLCGHLDLSPKVFNNAAWYNVIDDVDPHYL--.KHFKEFMGSQRDWQSNTKYGKP
VAL1_PHUV/7-290 FRLNAKNYFLTYPQCSISKEERLAQLQNLSTPVNKK.YIKICKESHEDGQPHLHVLIQFEGKYQCTNNRFFDLVSSTR.SAHFHPNIQGAKSSSDVKTYIDKDG-.--DTVEWGEFQIDGRSARGGQQSANDTYAKALNSASAEEALQIIKEEQPQHFFLQFHNIVSNANRIFQTPPEPWVPPFQQASFNNVPAIMTQWVSDN-VCDAAARPMRPLSLVVEGPSRTGKTLWARSLGPHNYICGHMDLSPKIYSNNAWYNVIDDIPPHYV--.KHFKEFMGAQRDWQSNCKYGKP
VAL1_PYMVV/7-293 FSIKAKNYFLTYPQCSISKEEALSQLQNLTIPVNKK.FIKICRELHENGEPHLHVLIQFEGKYNCTNNRLFDLVSPTR.STHFHPNIQGAKSSSDVKSYVEKDG-.--DTIEWGLFQIDGRSARGGQQTVNDAAAEALNSGTKEAAMKIIKEKLPEKFLFQYHNLSCNLDRIFMKAPETWAPPFPLSSFTNVPDEMQEWADGYFGKSSAARPERPISIIIEGDSRRGKTMWARVLGPHNYLSGHLDFNPRVYSNEVEYNVIDDVAPQYLKL.KHWKELLGAQRDWQSNCKYGKP
VAL1_BGMV/7-293 FRVQSKNYFLTYPRCTIPKEEALSQLQKIHTTTNKK.FIKVCEERHDNGEPHLHALIQFEGKFICTNKRLFDLVSTTR.SAHFHPNIQGAKSSSDVKEYIDKDG-.--VTIEWGQFQVDGRSARGGQQSANDSYAKALNADSIESALTILKEEQPKDYVLQNHNIRSNLERIFFKVPEPWVPPFPLSSFVNIPVVMQDWVDDYFGRGSAARPERPISIIVEGDSRTGKTMWARALGPHNYLSGHLDFNSLVYSNSVEYNVIDDITPNYLKL.KDWKELIGEQKDWQSNCKYGKP
VAL1_ABMVW/7-292 FRVQAKNYFLTYPQCSLTKDEALSQLQNLETPVNKK.FIKICRELHENGEPHLHVLIQFEGKYQCTNNRFFDLVSPTR.SAHFHPNIQGAKSSSDVKSYIDKDG-.--DTAEWGEFQIDGRSARGGQQTANDSYAKALNAGDVQSALNILKEEQPKDYVLQNHNIRSNLERIFAKAPEPWVAGFPSPLSRPFPRRCRSGRMIILGVVPLRP-DRPLSLIVEGDSRTGKTMWARALGPHNYLSGHLDFNGRVYSNEVEYNVIDDVAPHYLKL.KHWKELLGAQKDWQSNCKLAKP
VAL1_BCTV/7-293 FRIQAKNIFLTYPQCSLSKEEALEQIQGIQLSSNKK.YIKIARELHEDGQPHLHVLLQLEGKVQITNIRLFDLVSPTR.SAHFHPNIQGAKSSSDVKSYVDKDG-.--DTIEWGEFQIDGRSARGGQQTANDSYAKALNATSLEQALQILKEEQPKDYFLQHHNLLNNAQKIFQRAPDPWTPLFPLSSFTNVPEEMQEWADAYFGVDAAARPLRYNSIIVEGDSRTGKTMWARSLGAHNYITGHLDFSLRTYYDEVEYNVIDDVDPTYLKM.KHWKHLIGAQKEWQTNLKYGKP
VAL1_SLCV/8-289 FRLTARNIFLTYPRCDVPKEEVLEMLLHLSWSVVKPnYVRVAREEHSDGSPHLHCLIQLSGKSNIKDAGFFDLTHPRR.SARFHPNIQAAKDTNAVKNYITKEG-.--DYCESGQYKVSG----GSKSNKDDVYHNAVNAGSAGEALDIIKAGDPKTFIVNYHNLLANVERLFQKPPEPWVPPFELSSFTSVPEELQDWADDYFNECSAAA--RPTSIIIEGGSRTGKTMWARSLGPHNYLSGHLDFNSRVFSNDVKYNVIDDVAPHYLKL.KHWKELIGAQRDWQSNCKYGKP