EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00726 alignment
(3 sequences with 170 aa)


IL10_MERUN/5-174 ALLYCLILLAGVRPSRGEYPRNESNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLQQDFKGYLGCQALSEMIQFYLVEVMPQAENHGPEIKENLNSLGEKLKTLRMQLRRCHRFLPCENKSKAVEQVKNDFNKLQEKGVYKAMNEFDIFINCIEAYMTI
IL10_BOVIN/5-174 ALLCCLVFLAGVAASRDASTLSDSSCIHLPTSLPHMLRELRAAFGEAKTFFQMKDQLHSLLLTQSLLDDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKLKTLRLRLRRCHRFLPCENKSKAVEKVKRVFSELQERGVYKAMSEFDIFINYIETYMTT
BCRF1_EBV/7-167 VTLQCLVLL---------YLAPECGGTDQCDNFPQMLRDLRDAFSRVKTFFQTKDEVDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPEAKDHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQIKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTI