EMBL-EBI > Goldman Group

PANDIT Home | Browse PANDIT | Help on PANDIT | Release notes | Pfam



PANDIT Homepage
pan•dit
PANDIT
Protein and Associated NucleotideDomains with Inferred Trees

PF00360 alignment
(9 sequences with 182 aa)


PHY_ADICA/402-581 ILRTQTLLCDMLLR.DAPIGIVSQSPNIMDLVTCDGAALYYGKKCWLLGTTPTEAQIVDIAAWLLDCHK.DSTGLSTDSLAKTGYPEASCLGDAVCGLAAAKITATDFLFWFRSHTAKEVRWGGARHDPEERDDGRRMHPRSSFKAFLEVVKQQSLPWEDVEMDAIHSLQLILRGSFQDIDD
PHY1_SELMA/412-591 ILRTQTLLCDMLLR.DAPIGIVSQSPNIMDLVKCDGAALYYGKRFWLLGITPSEAQIKDIAEWLLEHHK.DSTGLSTDSLADAGYPGAASLGDEVCGMAAAKITAKDFLFWFRSHTAKEVKWGGAKHDPDDKDDGRKMHPRSSFKAFLEVVKRRSLPWEDVEMDAIHSLQLILRGSFQDIDD
PHY1_PHYPA/406-585 ILRTQTLLCDMLLR.DAPIGIVSQIPNIMDLVKCDGAALYYGKPFWLLGTTPTESQIKDIAEWLLEYHK.DSTGLSTDSLADANYPAAHLLGDAVCGMAAAKITAKDFLFWFRSHTAKEIKWGGAKHDPGENHDGRKMHPRSSFKAFLEVVKRRSLPWEDVEMDAIHSLQLILRGSFQDIAD
PHYB_SOLTU/417-596 VLRTQTLLCDMLLR.DSPPGIVTQSPSIMDLVKCDGAALYYQGKYYPLGVTPTEAQIKDIVEWLLAYHG.DSTGLSTDSLPDAGYPGAASLGDAVCGMAVAYITSKDFLFWFRSHTAKEIKWGGAKHHPEDKDDGQRMHPRSSFKAFLEVVKSRSSPWENAEMDAIHSLQLILRDSFKDAEA
PHYA3_AVESA/412-592 ILKMQTMLSDMLFReASPLTIVSGTPNIMDLVKCDGAALLYGGKVWRLRNAPTESQIHDIAFWLSDVHR.DSTGLSTDSLHDAGYPGAAALGDMICGMAVAKINSKDILFWFRSHTAAEIRWGGAKNDPSDMDDSRRMHPRLSFKAFLEVVKMKSLPWSDYEMDAIHSLQLILRGTLNDASK
PHYA_SOYBN/410-589 ILHHPGHLLCMLMR.DAPLGIASESPNIMDLVKCDGAALIYRNKVWRLGVTPSEPQIREIALWLSEYHM.DSTSFSTDSLFDAGFPSALSLGDVVCGMASVRVTAKDMVFWFRSHTAAEIRWGGAKHEAGEKDDSRRMHPRSSFKAFLEVVKARSLPWKEYEMDAIHSLQIILRNAFKEDTE
PHYA1_TOBAC/412-590 ILRTQTLLCDMLMR.VAPLGIVSQSPNIMDLVKCDGAALLYKNKIHRLGMTPSDFQLHDIVSWLSEYHT.DSTGLSTDSLYDAGFPGALALGDVVCGMAAVRISDKGWLFWYRSHTAAEVRWGGAKHEPGEKDDGRKMHPRSSFKAFLEVVKTRSVPWKDYEMDAIHSLQLILRNAS-KDAD
PHYE_ARATH/398-578 AMRTQTLLCDMLLR.DTVSAIVTQSPGIMDLVKCDGAALYYKGKCWLVGVTPNESQVKDLVNWLVENHGdDSTGLTTDSLVDAGYPGAISLGDAVCGVAAAEFSSKDYLLWFRSNTASAIKWGGAKHHPKDKDDAGRMHPRSSFTAFLEVAKSRSLPWEISEIDAIHSLRLIMRESFTSSRP
PHYC_ARATH/404-582 ILQTQSVLCDMLFR.NAPIGIVTQSPNIMDLVKCDGAALYYRDNLWSLGVTPTETQIRDLIDWVLKSHG.GNTGFTTESLMESGYPDASVLGESICGMAAVYISEKDFLFWFRSSTAKQIKWGGARHDPNDRD-GKRMHPRSSFKAFMEIVRWKSVPWDDMEMDAINSLQLIIKGSLQEEHS