ID   AY095226; SV 1; linear; mRNA; STD; VRL; 166 BP.
XX
AC   AY095226;
XX
DT   02-JUL-2002 (Rel. 72, Created)
DT   29-NOV-2004 (Rel. 81, Last updated, Version 4)
XX
DE   Influenza A virus (A/Brant Goose/1/1917(H1N?)) hemagglutinin H1 subtype
DE   (HA) mRNA, partial cds.
XX
KW   .
XX
OS   Influenza A virus (A/Brant Goose/1/1917(H1N?))
OC   Viruses; Riboviria; Negarnaviricota; Polyploviricotina; Insthoviricetes;
OC   Articulavirales; Orthomyxoviridae; Alphainfluenzavirus.
XX
RN   [1]
RP   1-166
RX   DOI; 10.1128/JVI.76.15.7860-7862.2002.
RX   PUBMED; 12097598.
RA   Fanning T.G., Slemons R.D., Reid A.H., Janczewski T.A., Dean J.,
RA   Taubenberger J.K.;
RT   "1917 avian influenza virus sequences suggest that the 1918 pandemic virus
RT   did not acquire its hemagglutinin directly from birds";
RL   J. Virol. 76(15):7860-7862(2002).
XX
RN   [2]
RP   1-166
RA   Fanning T.G., Slemons R.D., Reid A.H., Janczewski T.A., Dean J.,
RA   Taubenberger J.K.;
RT   "Relationship of Pre-1918 Avian Influenza HA and NP Sequences to Subsequent
RT   Avian Influenza Strains";
RL   Avian Dis. 0:0(2002).
XX
RN   [3]
RP   1-166
RA   Fanning T.G., Slemons R.D., Reid A.H., Janczewski T.A., Dean J.,
RA   Taubenberger J.K.;
RT   ;
RL   Submitted (10-APR-2002) to the INSDC.
RL   Cellular Pathology and Genetics, Armed Forces Institute of Pathology, 1413
RL   Research Blvd., Bldg. 101, Rm. 1057D, Rockville, MD 20850-3125, USA
XX
DR   MD5; 1e628ce424f6395fb04a3db3d6528968.
DR   EuropePMC; PMC136362; 12097598.
DR   EuropePMC; PMC2268457; 18234791.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..166
FT                   /organism="Influenza A virus (A/Brant Goose/1/1917(H1N?))"
FT                   /strain="A/Brant goose/1/1917 (H1N?)"
FT                   /mol_type="mRNA"
FT                   /note="obtained from preserved Brant goose (Branta
FT                   bernicula) specimen from the Smithsonian Institution's
FT                   Museum of Natural History; specimen was originally
FT                   collected by G.D. Hanna from St. Paul Island, Pribilof
FT                   Islands, Alaska, on Sept. 9, 1917"
FT                   /db_xref="taxon:194387"
FT   CDS             <1..>166
FT                   /codon_start=2
FT                   /gene="HA"
FT                   /product="hemagglutinin H1 subtype"
FT                   /db_xref="GOA:Q8JMV7"
FT                   /db_xref="InterPro:IPR001364"
FT                   /db_xref="InterPro:IPR008980"
FT                   /db_xref="InterPro:IPR013828"
FT                   /db_xref="UniProtKB/TrEMBL:Q8JMV7"
FT                   /protein_id="AAM22277.1"
FT                   /translation="YSGASSFYRNLLWLTKKGTSYPKLSKSYTNNKGKEVLVLWGVHHP
FT                   PTTSEQQSLY"
XX
SQ   Sequence 166 BP; 54 A; 39 C; 37 G; 36 T; 0 other;
     ctactctgga gccagcagtt tttatcggaa tttgctgtgg ctaacaaaga agggaacttc        60
     atatccaaag ctcagcaaat catacacgaa caataaggga aaagaagtgc ttgtactctg       120
     gggagtgcac catcctccga ccaccagtga gcaacagagt ctatac                      166
//