ID S71597; SV 1; linear; mRNA; STD; ROD; 531 BP. XX AC S71597; XX DT 23-OCT-1994 (Rel. 41, Created) DT 17-APR-2005 (Rel. 83, Last updated, Version 4) XX DE iNOS=inducible nitric oxide synthase [rats, kidney, glomeruli and medulla, DE Sprague-Dawley, mRNA Partial, 531 nt]. XX KW . XX OS Rattus norvegicus (Norway rat) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; OC Murinae; Rattus. XX RN [1] RC GenBank staff at the National Library of Medicine created this entry [NCBI RC gibbsq 150863] from the original journal article. RP 1-531 RX DOI; 10.1038/ki.1994.135. RX PUBMED; 7516453. RA Morrissey J.J., McCracken R., Kaneto H., Vehaskari M., Montani D., RA Klahr S.; RT "Location of an inducible nitric oxide synthase mRNA in the normal kidney"; RL Kidney Int. 45(4):998-1005(1994). XX DR MD5; 7acf9c1e846e5f236590d5a7bf94cae8. XX FH Key Location/Qualifiers FH FT source 1..531 FT /organism="Rattus norvegicus" FT /strain="Sprague-Dawley" FT /mol_type="mRNA" FT /tissue_type="kidney glomeruli and medulla" FT /db_xref="taxon:10116" FT gene <1..>531 FT /gene="iNOS" FT /note="inducible nitric oxide synthase, iNOS" FT CDS <1..>531 FT /codon_start=1 FT /gene="iNOS" FT /product="inducible nitric oxide synthase" FT /note="conceptual translation presented here differs from FT translation in publication; FT mismatches(511[L->W],560[T->N])" FT /db_xref="GOA:Q06518" FT /db_xref="InterPro:IPR001094" FT /db_xref="InterPro:IPR001433" FT /db_xref="InterPro:IPR001709" FT /db_xref="InterPro:IPR003097" FT /db_xref="InterPro:IPR004030" FT /db_xref="InterPro:IPR008254" FT /db_xref="InterPro:IPR012144" FT /db_xref="InterPro:IPR017927" FT /db_xref="InterPro:IPR017938" FT /db_xref="InterPro:IPR023173" FT /db_xref="InterPro:IPR029039" FT /db_xref="InterPro:IPR036119" FT /db_xref="InterPro:IPR039261" FT /db_xref="UniProtKB/Swiss-Prot:Q06518" FT /protein_id="AAB31028.2" FT /translation="NYVLSPFYYYQIEPWKTHIWQDEKLRPRRREIRFTVWVKAVFFAS FT VLMRKVMASRVRATVLFATETRKSEALARDLASLFSYAFNNKVVCMDQYKANTLEEEQL FT LLVVTSTFANGDCPSNGQTLKKSLFMMKELGHTFRYAVFGLGSSMYPQFCAFAHDIDQK FT LSHLGASQLAPTGE" XX SQ Sequence 531 BP; 132 A; 142 C; 138 G; 119 T; 0 other; aactacgtcc tatctccatt ctactactac cagatcgagc cctggaagac ccacatctgg 60 caggatgaga agctgaggcc caggaggaga gagatccggt tcacagtctg ggtgaaagcg 120 gtgttctttg cttctgtgct aatgcggaag gtcatggctt cccgcgtcag agccacagtc 180 ctctttgcta ctgagacaag gaagtcggaa gcgctagcca gggacctggc ttccttgttc 240 agctacgcct tcaacaacaa ggttgtctgc atggaccagt ataaggcaaa caccttggaa 300 gaggaacaac tactgctggt ggtgacaagc acatttgcga atggagactg ccccagcaat 360 gggcagactc tgaagaaatc tctattcatg atgaaagaac tcgggcatac cttcaggtat 420 gcggtatttg gcctgggctc cagcatgtac cctcagttct gtgcctttgc tcatgacatc 480 gaccagaaac tgtctcacct gggagcctcc cagcttgccc caaccggaga a 531 //