ID OK194671; SV 1; linear; genomic DNA; STD; INV; 215 BP. XX AC OK194671; XX DT 23-JUN-2022 (Rel. 144, Created) DT 29-JUN-2022 (Rel. 144, Last updated, Version 1) XX DE Isospora coerebae isolate small cytochrome c oxidase subunit I (COX1) gene, DE partial cds; mitochondrial. XX KW . XX OS Isospora coerebae OC Eukaryota; Sar; Alveolata; Apicomplexa; Conoidasida; Coccidia; OC Eucoccidiorida; Eimeriorina; Eimeriidae; Isospora. OG Mitochondrion XX RN [1] RP 1-215 RA Ortuzar-Ferreira C.N., Andrade L.A.S., Genovez-Oliveira J.L., RA Oliveira M.S., Mello E.R., Cardozo S.V., Oliveira A.A., Lima V.M., RA Ferreira I., Berto B.P.; RT "Molecular identification of Isospora coerebae Berto, Flausino, Luz, RT Ferreira & Lopes, 2010 (Chromista: Miozoa: Eimeriidae) from the bananaquit RT Coereba flaveola (Linnaeus, 1758) (Passeriformes: Thraupidae: Coerebinae) RT from Brazil"; RL Unpublished. XX RN [2] RP 1-215 RA Ortuzar-Ferreira C.N., Andrade L.A.S., Genovez-Oliveira J.L., RA Oliveira M.S., Mello E.R., Cardozo S.V., Oliveira A.A., Lima V.M., RA Ferreira I., Berto B.P.; RT ; RL Submitted (18-SEP-2021) to the INSDC. RL Departamento de Biologia Animal, Universidade Federal Rural do Rio de RL Janeiro, BR 465, Km7, Seropedica, Rio de Janeiro 23.897-000, Brasil XX DR MD5; c0e5deffa78fde038f48ef3278cf5062. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..215 FT /organism="Isospora coerebae" FT /organelle="mitochondrion" FT /host="Coereba flaveola" FT /isolate="small" FT /mol_type="genomic DNA" FT /country="Brazil" FT /isolation_source="feces" FT /specimen_voucher="115/2021" FT /db_xref="taxon:2952508" FT gene <1..>215 FT /gene="COX1" FT CDS <1..>215 FT /codon_start=3 FT /transl_table=4 FT /gene="COX1" FT /product="cytochrome c oxidase subunit I" FT /protein_id="USH96628.1" FT /translation="AYFSAITMMIAIPTGTKIFNWLGTFMGNPFSTISLDIWYALSFIF FT LFTLGGTTGVVLGNSAVDVALHDTYY" XX SQ Sequence 215 BP; 57 A; 38 C; 37 G; 83 T; 0 other; gagcatactt ctctgctatt acaatgatga ttgcaattcc tacaggaacc aaaattttca 60 attggttagg tacttttatg ggtaatccat tcagtacaat ttcattagac atttggtatg 120 ctctaagttt tatcttccta tttacccttg gaggtactac tggtgtagta ttaggtaact 180 ctgctgttga tgttgctcta catgatacat actat 215 //