ID MW267130; SV 1; linear; genomic DNA; STD; INV; 312 BP. XX AC MW267130; XX DT 30-DEC-2021 (Rel. 144, Created) DT 30-DEC-2021 (Rel. 144, Last updated, Version 1) XX DE Rhopalomastix sp. 2 WYW-2020 voucher ZRC_ENT00000938-B cytochrome c oxidase DE subunit I (COX1) gene, partial cds; mitochondrial. XX KW . XX OS Rhopalomastix sp. 2 WYW-2020 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Endopterygota; Hymenoptera; Apocrita; Aculeata; Formicoidea; OC Formicidae; Myrmicinae; Rhopalomastix; unclassified Rhopalomastix. OG Mitochondrion XX RN [1] RP 1-312 RA Wang W.Y., Yong G.W., Jaitrong W.; RT "Revision of the elusive ant genus Rhopalomastix (Hymenoptera, Formicidae, RT Myrmicinae) in Thailand based on morphology and DNA barcodes, with RT descriptions of three new species"; RL Unpublished. XX RN [2] RP 1-312 RA Wang W.Y.; RT ; RL Submitted (17-NOV-2020) to the INSDC. RL Lee Kong Chian Natural History Museum, National University of Singapore, 2 RL Conservatory Drive, Singapore 117377, Singapore XX DR MD5; d6a85ed3311f697fb8f1f94c810fbd22. XX CC ##Assembly-Data-START## CC Assembly Method :: PEAR v. 0.9.6 CC Sequencing Technology :: Illumina CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..312 FT /organism="Rhopalomastix sp. 2 WYW-2020" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /specimen_voucher="ZRC_ENT00000938-B" FT /db_xref="taxon:2790090" FT gene <1..>312 FT /gene="COX1" FT CDS <1..>312 FT /codon_start=1 FT /transl_table=5 FT /gene="COX1" FT /product="cytochrome c oxidase subunit I" FT /protein_id="QPF16370.1" FT /translation="LASNIFHSGPSIDLLIFSLHIAGMSSILGAINFISTILNMHHENI FT YLDKIPLLIWSIFITTILLLLALPILAGAITMLLTDRNLNTSFFDPVGGGDPILYQHLF" XX SQ Sequence 312 BP; 93 A; 68 C; 33 G; 118 T; 0 other; ttagcatcaa atatcttcca cagaggccct tcaattgatc ttctaatctt ctctcttcat 60 attgcaggaa tatcatctat tttaggggct attaatttta tctccacaat cttaaatata 120 catcatgaaa atatttacct agacaaaatt cctttactta tttgatcaat ttttatcaca 180 acaatcttac tccttttagc tttaccaatc ttagcagggg caattaccat acttctaaca 240 gaccgtaatt taaatacttc tttctttgac cctgtagggg gaggagaccc tattctttac 300 caacatttat tt 312 //