ID MW267049; SV 1; linear; genomic DNA; STD; INV; 312 BP. XX AC MW267049; XX DT 30-DEC-2021 (Rel. 144, Created) DT 30-DEC-2021 (Rel. 144, Last updated, Version 1) XX DE Rhopalomastix sp. 3 WYW-2020 voucher ZRC_ENT00000939-A cytochrome c oxidase DE subunit I (COX1) gene, partial cds; mitochondrial. XX KW . XX OS Rhopalomastix sp. 3 WYW-2020 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Endopterygota; Hymenoptera; Apocrita; Aculeata; Formicoidea; OC Formicidae; Myrmicinae; Rhopalomastix; unclassified Rhopalomastix. OG Mitochondrion XX RN [1] RP 1-312 RA Wang W.Y., Yong G.W., Jaitrong W.; RT "Revision of the elusive ant genus Rhopalomastix (Hymenoptera, Formicidae, RT Myrmicinae) in Thailand based on morphology and DNA barcodes, with RT descriptions of three new species"; RL Unpublished. XX RN [2] RP 1-312 RA Wang W.Y.; RT ; RL Submitted (17-NOV-2020) to the INSDC. RL Lee Kong Chian Natural History Museum, National University of Singapore, 2 RL Conservatory Drive, Singapore 117377, Singapore XX DR MD5; aa9f0bbc72a598e1c3e232c5b86888f5. XX CC ##Assembly-Data-START## CC Assembly Method :: PEAR v. 0.9.6 CC Sequencing Technology :: Illumina CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..312 FT /organism="Rhopalomastix sp. 3 WYW-2020" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /specimen_voucher="ZRC_ENT00000939-A" FT /db_xref="taxon:2790091" FT gene <1..>312 FT /gene="COX1" FT CDS <1..>312 FT /codon_start=1 FT /transl_table=5 FT /gene="COX1" FT /product="cytochrome c oxidase subunit I" FT /protein_id="QPF16289.1" FT /translation="LASNIFHSGPSIDLLIFSLHIAGMSSILGAINFISSILNMHHKNI FT YLDKIPLLIWSILITTILLLLALPVLAGAITMLLTDRNLNTSFFDPTGGGDPILYQHLF" XX SQ Sequence 312 BP; 95 A; 63 C; 33 G; 121 T; 0 other; ctagcatcaa acatttttca cagggggccc tcaatcgatt tattaatttt ttccctccat 60 attgcaggca tatcatctat tttaggagct attaatttta tttcttcaat tttaaatata 120 catcataaaa atatttattt agataaaatt cccttactca tttgatcaat cttaatcaca 180 acaatcttac ttttattagc tctaccagtt ttagctgggg caattactat attattaaca 240 gatcgcaact taaatacttc cttttttgac cctaccggag ggggagaccc tatcttatac 300 caacatttat tt 312 //