ID MN955591; SV 1; linear; genomic DNA; STD; INV; 483 BP. XX AC MN955591; XX DT 25-JAN-2020 (Rel. 143, Created) DT 06-MAY-2020 (Rel. 144, Last updated, Version 2) XX DE Acroperus harpae voucher AYS-013_Acroperus harpae_Norway cytochrome c DE oxidase subunit I (COX1) gene, partial cds; mitochondrial. XX KW . XX OS Acroperus harpae OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea; Branchiopoda; OC Diplostraca; Cladocera; Anomopoda; Chydoridae; Acroperus. OG Mitochondrion XX RN [1] RP 1-483 RA Sinev A.Y., Karabanov D.P., Kotov A.A.; RT "A new North Eurasian species of the Alona affinis complex (Cladocera: RT Chydoridae)"; RL Zootaxa 4767(1):115-137(2020). XX RN [2] RP 1-483 RA Sinev A.Y., Karabanov D.P., Kotov A.A.; RT ; RL Submitted (16-JAN-2020) to the INSDC. RL Laboratory for Ecology of Aquatic Communities and Invasions, A.N. Severtsov RL Institute of ecology and evolution of the Russian Academy of Sciences, RL Leninskij prosp., 33, Moscow 119071, Russia XX DR MD5; 41fc6fbdf32969c76ada2f19bef48e42. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..483 FT /organism="Acroperus harpae" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /country="Norway" FT /lat_lon="59.97 N 10.72 E" FT /isolation_source="Sognsvann Lake, Oslo" FT /specimen_voucher="AYS-013_Acroperus harpae_Norway" FT /collected_by="A.Y. Sinev" FT /collection_date="07-Oct-2015" FT /identified_by="A.Y. Sinev" FT /db_xref="taxon:362322" FT gene <1..>483 FT /gene="COX1" FT CDS <1..>483 FT /codon_start=2 FT /transl_table=5 FT /gene="COX1" FT /product="cytochrome c oxidase subunit I" FT /protein_id="QHI34422.1" FT /translation="IIGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPD FT MAFPRLNNLSFWLLPPSLTLLLIGGAVESGAGTGWTVYPPLSAGIAHAGASVDLSIFSL FT HLAGISSILGAVNFITTVINMRSYGMTLDRIPLFVWAVAITALLLLLSLPVLAGAIT" XX SQ Sequence 483 BP; 112 A; 84 C; 90 G; 197 T; 0 other; tattattggt gatgatcaaa tttataatgt gattgtaaca gctcatgctt ttgtaataat 60 cttttttata gttataccca ttataattgg tggatttggt aattgattag ttcctttgat 120 attaggagct ccagacatag cttttccccg actgaacaac cttagatttt gacttttgcc 180 tccttctcta actttacttt tgattggagg tgctgtagaa agaggagcag gtactggttg 240 gactgtttac cctcccttat cagctgggat tgctcatgct ggtgcttctg tagacttgag 300 aattttttct cttcatttag caggtatttc ttctattcta ggtgctgtaa attttattac 360 tacagtaatt aatatacgat cttatggaat aacacttgat cgaattcctt tgtttgtctg 420 agcagtggcc attactgctc ttttgttact tcttagtcta cccgttttag caggtgctat 480 tac 483 //