ID MN955590; SV 1; linear; genomic DNA; STD; INV; 483 BP. XX AC MN955590; XX DT 25-JAN-2020 (Rel. 143, Created) DT 06-MAY-2020 (Rel. 144, Last updated, Version 2) XX DE Acroperus harpae voucher AYS-010_Acroperus harpae_Glubokoe cytochrome c DE oxidase subunit I (COX1) gene, partial cds; mitochondrial. XX KW . XX OS Acroperus harpae OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea; Branchiopoda; OC Diplostraca; Cladocera; Anomopoda; Chydoridae; Acroperus. OG Mitochondrion XX RN [1] RP 1-483 RA Sinev A.Y., Karabanov D.P., Kotov A.A.; RT "A new North Eurasian species of the Alona affinis complex (Cladocera: RT Chydoridae)"; RL Zootaxa 4767(1):115-137(2020). XX RN [2] RP 1-483 RA Sinev A.Y., Karabanov D.P., Kotov A.A.; RT ; RL Submitted (16-JAN-2020) to the INSDC. RL Laboratory for Ecology of Aquatic Communities and Invasions, A.N. Severtsov RL Institute of ecology and evolution of the Russian Academy of Sciences, RL Leninskij prosp., 33, Moscow 119071, Russia XX DR MD5; ac052ee36b9b4b7361ba7db2b387b257. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..483 FT /organism="Acroperus harpae" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /country="Russia" FT /lat_lon="55.75 N 36.51 E" FT /isolation_source="Moscow Area, Lake Glubokoe" FT /specimen_voucher="AYS-010_Acroperus harpae_Glubokoe" FT /collected_by="A.A. Kotov" FT /collection_date="01-Aug-2016" FT /identified_by="A.Y. Sinev" FT /db_xref="taxon:362322" FT gene <1..>483 FT /gene="COX1" FT CDS <1..>483 FT /codon_start=2 FT /transl_table=5 FT /gene="COX1" FT /product="cytochrome c oxidase subunit I" FT /protein_id="QHI34421.1" FT /translation="IIGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPD FT MAFPRLNNLSFWLLPPSLTLLLIGGAVESGAGTGWTVYPPLSAGIAHAGASVDLSIFSL FT HLAGVSSILGAVNFITTVINMRSYGMTLDRIPLFVWAVAITALLLLLSLPVLAGAIT" XX SQ Sequence 483 BP; 106 A; 88 C; 95 G; 194 T; 0 other; tattattggt gacgatcaaa tttataatgt aattgtaacg gctcatgctt ttgtaataat 60 cttttttata gttataccca tcataattgg tggttttggt aattgattag ttcctttgat 120 attaggagct ccagacatag cttttccccg attgaacaac cttagatttt gacttttgcc 180 tccttctctg actttacttt tgattggggg tgctgtagaa agaggggcag gtactggttg 240 gactgtctat cctcccttat cagctggaat tgctcatgct ggtgcttctg tagacttgag 300 aattttttcc cttcatttgg caggtgtttc ttctatccta ggtgctgtaa attttattac 360 tacagtaatt aatatacgat cttatggaat aacacttgat cgaattcctt tgtttgtctg 420 ggcagtggcc attactgctc ttttgttact tcttagccta cccgttttag caggtgctat 480 tac 483 //