ID MN662560; SV 1; linear; genomic DNA; STD; INV; 307 BP. XX AC MN662560; XX DT 07-MAY-2021 (Rel. 144, Created) DT 07-MAY-2021 (Rel. 144, Last updated, Version 1) XX DE Afrosyrphus varipes voucher CNC DIPTERA 102962 cytochrome oxidase subunit 1 DE (COI) gene, partial cds; mitochondrial. XX KW BARCODE. XX OS Afrosyrphus varipes OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Syrphoidea; OC Syrphidae; Syrphinae; Syrphini; Afrosyrphus. OG Mitochondrion XX RN [1] RP 1-307 RA Mengual X., Ssymank A., Skevington J.H., Reemer M., Staahls G.; RT "The genus Afrosyrphus Curran (Diptera, Syrphidae), with a description of a RT new species"; RL Eur J Taxon 0:0-0(2020). XX RN [2] RP 1-307 RA Mengual X., Ssymank A., Skevington J.H., Reemer M., Stahls G.; RT ; RL Submitted (08-NOV-2019) to the INSDC. RL Canadian National Collection of Insects, Arachnids and Nematodes, RL Agriculture and Agri-Food Canada, 960 Carling Avenue, K.W. Neatby Building, RL Ottawa, Ontario K1A0C6, Canada XX DR MD5; 03a69cd3af56d789efea19f99fc55db4. XX FH Key Location/Qualifiers FH FT source 1..307 FT /organism="Afrosyrphus varipes" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /country="Uganda: Central, Entebbe, Kisubi Forest" FT /specimen_voucher="CNC DIPTERA 102962" FT /collected_by="M.Paulus" FT /collection_date="24-Apr-1976" FT /identified_by="J. R. Vockeroth" FT /PCR_primers="fwd_seq: ggtcaacaaatcataaagatattgg, FT rev_seq:gttcawccwgtwccwgcyccattttc" FT /note="PCR_primers=fwd_seq: attcaaccaatcataaagatattgg" FT /db_xref="taxon:2829198" FT gene <1..>307 FT /gene="COI" FT CDS <1..>307 FT /codon_start=2 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /protein_id="QUA00670.1" FT /translation="TLYFLFGSWAGMVGTSLSILIRAELGHPGALIGDDQIYNVIVTAH FT AFVMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLMSSMV" XX SQ Sequence 307 BP; 89 A; 41 C; 50 G; 127 T; 0 other; aacattatat tttctatttg gttcttgagc tggaatagta ggaacttctt taagaatttt 60 aattcgagca gagcttggtc acccaggtgc tctaattggt gatgatcaaa tttataatgt 120 aattgttact gctcatgctt ttgttataat tttctttatg gtaataccaa ttataattgg 180 aggatttgga aattgattag ttcctttaat attaggagcc cctgatatag cttttcctcg 240 attaaacaat ataagttttt gattattacc tccttcttta acacttttat taataagaag 300 aatggtt 307 //