ID MK830047; SV 1; linear; genomic DNA; STD; INV; 324 BP. XX AC MK830047; XX DT 22-NOV-2019 (Rel. 143, Created) DT 22-NOV-2019 (Rel. 143, Last updated, Version 1) XX DE Phimochirus holthuisi isolate ULLZ16588 histone 3 (H3) gene, partial cds. XX KW . XX OS Phimochirus holthuisi OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea; Multicrustacea; OC Malacostraca; Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Anomura; OC Paguroidea; Paguridae; Phimochirus. XX RN [1] RC DOI: 10.11646/zootaxa.4683.4.4 RP 1-324 RA Felder D.L., Lemaitre R., Craig C.; RT "Two new species of the Phimochirus holthuisi complex from the Gulf of RT Mexico, supported by morphology, color, and genetics (Crustacea: Anomura: RT Paguridae)"; RL Zootaxa 4683(4):531-551(2019). XX RN [2] RP 1-324 RA Felder D.L., Lemaitre R., Craig C.W.; RT ; RL Submitted (23-APR-2019) to the INSDC. RL Biological Sciences, University of Louisiana, Lafayette, 410 E. St. Mary RL Blvd., Billeaud Hall, Room 108, Lafayette, LA 70503, USA XX DR MD5; b40c6615eeb8370b96d590cf300afdc6. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..324 FT /organism="Phimochirus holthuisi" FT /isolate="ULLZ16588" FT /mol_type="genomic DNA" FT /db_xref="taxon:1377947" FT gene <1..>324 FT /gene="H3" FT mRNA <1..>324 FT /gene="H3" FT /product="histone 3" FT CDS <1..>324 FT /codon_start=3 FT /gene="H3" FT /product="histone 3" FT /protein_id="QGI57851.1" FT /translation="STGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRY FT QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIH FT AKR" XX SQ Sequence 324 BP; 65 A; 105 C; 93 G; 61 T; 0 other; agagtaccgg aggaaaggcc cctcgcaagc agctggccac caaggctgct cgcaagtcgg 60 cccctgccac tggaggagtc aagaaacctc accgttacag gcctggtacc gtggctctgc 120 gtgagatccg tcgttaccag aagagcactg agctcctcat caggaagctg cccttccagc 180 ggctggtgcg tgagattgcc caggacttca agactgatct ccgcttccag tcctctgccg 240 tcatggctct gcaggaagcc tccgaggcct acctggtggg gcttttcgag gacaccaacc 300 tgtgcgccat ccacgctaag cgtg 324 //