ID MK682606; SV 1; linear; genomic DNA; STD; INV; 214 BP. XX AC MK682606; XX DT 14-OCT-2019 (Rel. 142, Created) DT 14-OCT-2019 (Rel. 142, Last updated, Version 1) XX DE Isospora sepetibensis voucher 92/2019 cytochrome c oxidase subunit I (COX1) DE gene, partial cds; mitochondrial. XX KW . XX OS Isospora sepetibensis OC Eukaryota; Sar; Alveolata; Apicomplexa; Conoidasida; Coccidia; OC Eucoccidiorida; Eimeriorina; Eimeriidae; Isospora. OG Mitochondrion XX RN [1] RP 1-214 RA Genovez-Oliveira J.L., Cardozo S.V., de Oliveira A.A., de Lima V.M., RA Ferreira I., Berto B.P.; RT "Morphological and Molecular Identification of Isospora sepetibensis RT (Chromista: Miozoa: Eimeriidae) from a New Host, Trichothraupis melanops RT (Passeriformes: Thraupidae: Tachyphoninae) in South America"; RL Acta Protozool. 58(1):17-23(2019). XX RN [2] RP 1-214 RA de Oliveira J.L.G., de Oliveira A.A., de Lima V.M., Ferreira I., RA Berto B.P.; RT ; RL Submitted (23-MAR-2019) to the INSDC. RL Departamento de Biologia Animal, Universidade Federal Rural do Rio de RL Janeiro, BR 465, Km7, Seropedica, Rio de Janeiro 23.897-000, Brasil XX DR MD5; bbf34e538c235fb89f520f029a760c80. XX FH Key Location/Qualifiers FH FT source 1..214 FT /organism="Isospora sepetibensis" FT /organelle="mitochondrion" FT /host="Trichothraupis melanops" FT /mol_type="genomic DNA" FT /country="Brazil" FT /isolation_source="feces" FT /specimen_voucher="92/2019" FT /PCR_primers="fwd_seq: gwtcattagtatgggcacatca, rev_seq: FT ccaagagataatacraartggaa" FT /PCR_primers="fwd_seq: gggcacatcatatgatgac, rev_seq: FT atagtatgtatcatgtarwgcaa" FT /db_xref="taxon:2559820" FT gene <1..>214 FT /gene="COX1" FT CDS <1..>214 FT /codon_start=3 FT /transl_table=4 FT /gene="COX1" FT /product="cytochrome c oxidase subunit I" FT /protein_id="QFG01524.1" FT /translation="GAHHMMTVGLETDTRAYFSAITMMIAIPTGTKIFNWLSTFMGNPF FT STISLDIWYALSFIFLFTLGGTTGVV" XX SQ Sequence 214 BP; 62 A; 38 C; 39 G; 75 T; 0 other; ttggggcaca tcatatgatg acagtaggtc tagaaacaga tactagagca tacttctctg 60 ctatcacaat gatgattgca attcctacag gaaccaaaat tttcaattgg ttaagtactt 120 ttatgggtaa tccattcagt acaatttcat tagacatttg gtatgctcta agttttatct 180 tcctatttac ccttggaggt actactggtg tagt 214 //