ID MK516815; SV 1; linear; genomic DNA; STD; PLN; 492 BP. XX AC MK516815; XX DT 09-SEP-2019 (Rel. 142, Created) DT 09-SEP-2019 (Rel. 142, Last updated, Version 1) XX DE Dictyota falklandica voucher F1720301 ribulose-1,5-bisphosphate DE carboxylase/oxygenase large subunit (rbcL) gene, partial cds; chloroplast. XX KW . XX OS Dictyota falklandica OC Eukaryota; Sar; Stramenopiles; Ochrophyta; PX clade; Phaeophyceae; OC Dictyotales; Dictyotaceae; Dictyota. OG Plastid:Chloroplast XX RN [1] RP 1-492 RA Kuepper F.C., Peters A., Macaya E., Kytinou E., Asensi A., Vieira C., RA De Clerck O.; RT "Dictyota falklandica sp. nov. (Dictyotales, Phaeophyceae) from the RT Falkland Islands and southernmost South America, and its relationships with RT other temperate Southern Hemisphere species"; RL Phycologia 0:0(2019). XX RN [2] RP 1-492 RA Kuepper F.C., Peters A., Macaya E., Kytinou E., Asensi A., Vieira C., RA De Clerck O.; RT ; RL Submitted (12-FEB-2019) to the INSDC. RL Phycology Research Group, Ghent University, Krijglaan 281, S8, Ghent 9000, RL Belgium XX DR MD5; 2ca41dd8f054d905b6ecd27b34b08b6a. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..492 FT /organism="Dictyota falklandica" FT /organelle="plastid:chloroplast" FT /mol_type="genomic DNA" FT /country="Falkland Islands (Islas Malvinas):East Falkland, FT San Carlos, Blue Beach" FT /lat_lon="51.57 S 59.04 W" FT /specimen_voucher="F1720301" FT /collected_by="F. Kupper" FT /db_xref="taxon:2607331" FT gene <1..>492 FT /gene="rbcL" FT CDS <1..>492 FT /codon_start=1 FT /transl_table=11 FT /gene="rbcL" FT /product="ribulose-1,5-bisphosphate carboxylase/oxygenase FT large subunit" FT /protein_id="QEL09413.1" FT /translation="DADYNVKETDILALFRITPQPGVDPVEAAAAVAGESSTATWTVVW FT TDLLTACDIYRAKAYRVDPVPGTNDQFFAYIAYECDLFEEGSLANLTASIIGNVFGFKA FT VKALRLEDMRIPFAFLKTFQGPATGVIVERERLDKFGRPLLGATVKPKLGLSGKNYGRV FT V" XX SQ Sequence 492 BP; 147 A; 86 C; 106 G; 153 T; 0 other; gatgctgatt ataacgtaaa agaaactgat attctagctt tattccgaat cacacctcag 60 cccggcgtgg atccggtaga ggctgctgcc gcagtagcgg gagaatcctc aactgctacg 120 tggactgttg tttggactga tttattaaca gcctgcgaca tttatagagc aaaagcttat 180 cgagtagatc cagtacctgg tacaaatgat caattttttg catatatcgc atatgaatgt 240 gatctattcg aagaaggttc attagcaaac ttaacagcat caattattgg taacgttttt 300 ggttttaaag ctgttaaagc attacgttta gaagatatga gaattccatt cgcattttta 360 aaaacattcc aaggtcctgc tacaggggtg attgtagaaa gagaaagatt agataaattt 420 ggtcgtcctc tattaggtgc cacagttaag cctaaactag gtctttctgg taaaaactat 480 ggtcgtgttg tt 492 //