ID MK033624; SV 1; linear; genomic DNA; STD; INV; 130 BP. XX AC MK033624; XX DT 17-APR-2019 (Rel. 140, Created) DT 17-APR-2019 (Rel. 140, Last updated, Version 1) XX DE Lamellomorpha strongylata voucher NIWA 51267 cytochrome c oxidase subunit I DE gene, partial cds; mitochondrial. XX KW . XX OS Lamellomorpha strongylata OC Eukaryota; Metazoa; Porifera; Demospongiae; Heteroscleromorpha; OC Tetractinellida; Astrophorina; Vulcanellidae; Lamellomorpha. OG Mitochondrion XX RN [1] RP 1-130 RA Kelly M., Cardenas P., Rush N., Sim-Smith C., McPherson D., Page M., RA Bell L.J.; RT "Molecular study supports the position of New Zealand endemic genus RT Lamellomorpha in family Vulcanellidae (Demospongiae, Tetractinellida, RT Astrophorina), with the description of three new species"; RL Eur J Taxon 506:1-25(2019). XX RN [2] RP 1-130 RA Cardenas P.; RT ; RL Submitted (06-OCT-2018) to the INSDC. RL Pharmacognosy, Dept. Medicinal Chemistry, Uppsala University, Husargatan 3, RL UPPSALA SE-75123, Sweden XX DR MD5; c7b2e37360078b465655b80b47f97288. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..130 FT /organism="Lamellomorpha strongylata" FT /organelle="mitochondrion" FT /mol_type="genomic DNA" FT /country="New Zealand:Three Kings Islands" FT /lat_lon="34.36 S 172.69 E" FT /specimen_voucher="NIWA 51267" FT /collection_date="27-Jan-1999" FT /identified_by="M. Kelly" FT /note="depth: 48 m" FT /db_xref="taxon:1336867" FT CDS <1..>130 FT /codon_start=2 FT /transl_table=4 FT /product="cytochrome c oxidase subunit I" FT /note="COI" FT /db_xref="GOA:A0A4D6DJL1" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A4D6DJL1" FT /protein_id="QBZ38480.1" FT /translation="TLYLLFGAFSGMIGTGFSFLIRLELSAPGSMLGDDHLYNVIIT" XX SQ Sequence 130 BP; 32 A; 26 C; 27 G; 45 T; 0 other; gaccttatac ttattatttg gcgccttttc gggtatgata ggaactggat ttagttttct 60 tattagacta gaactatcgg cccccggatc aatgctgggg gatgaccatc tttacaacgt 120 cataattact 130 //