ID MK014094; SV 1; linear; genomic DNA; STD; INV; 394 BP. XX AC MK014094; XX DT 06-FEB-2020 (Rel. 143, Created) DT 06-FEB-2020 (Rel. 143, Last updated, Version 1) XX DE Typhlodromus kerkirae isolate Montferrier sur Lez Cirad de Baillarguet4 DE cytochrome b (cytb) gene, partial cds; mitochondrial. XX KW . XX OS Typhlodromus kerkirae OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Chelicerata; Arachnida; Acari; OC Parasitiformes; Mesostigmata; Gamasina; Phytoseioidea; Phytoseiidae; OC Typhlodrominae; Typhlodromus. OG Mitochondrion XX RN [1] RC Publication Status: Online-Only RP 1-394 RX PUBMED; 31717189. RA Tixier M.S., Dennj P., Douin M., Kreiter S., Haralabos T.; RT "Mites of the genus Typhlodromus (Acari: Phytoseiidae) from Southern RT France: combined morphological and molecular approaches for species RT identification"; RL Zootaxa 4604(2):242-280(2019). XX RN [2] RP 1-394 RA Tixier M.-S., Principato D., Tsolakis H.; RT ; RL Submitted (30-SEP-2018) to the INSDC. RL Dept Biology & Ecology, Montpellier SupAgro, 2 place Viala, Montpellier RL 34000, France XX DR MD5; d16cd4a25b41491719e0085bd31e9dbd. XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..394 FT /organism="Typhlodromus kerkirae" FT /organelle="mitochondrion" FT /host="Dittrichia viscosa" FT /isolate="Montferrier sur Lez Cirad de Baillarguet4" FT /mol_type="genomic DNA" FT /country="France" FT /db_xref="taxon:2653365" FT gene complement(<1..>394) FT /gene="cytb" FT CDS complement(<1..>394) FT /codon_start=1 FT /transl_table=5 FT /gene="cytb" FT /product="cytochrome b" FT /protein_id="QHS01959.1" FT /translation="FWGATVITNLLSSVPYIGTSMTYWLWGDFSVNKATLMRFFSFHFF FT LPFIISLSVILHILFLHEKGSNNPLGVNSEIDKVSFNPFFVWKDLMGFMMCLIIFLTLI FT NIYPYIFMDPDNFMPANPMVTPPHIQP" XX SQ Sequence 394 BP; 153 A; 44 C; 77 G; 120 T; 0 other; cgggttggat atgaggagga gttactatag gattggctgg tataaaatta tcaggatcca 60 taaaaatata tgggtagata ttgattaggg ttaaaaagat aattagacat attatgaatc 120 ctattaagtc ttttcataca aaaaaagggt taaaagacac tttatcaatt tcggaattta 180 cccctaaagg gttgttcgat cctttttcat gaaggaataa gatatgtaaa ataactctta 240 gactgataat gaaaggtaaa aagaaatgga atctaaaaaa tcgtatgaga gttgctttat 300 ttacagaaaa atctcctcag agtcaatatg ttattgatgt tccaatatag ggaacggaag 360 atagaagatt agtaattaca gtagctcctc aaaa 394 //