ID MH726210; SV 1; linear; genomic DNA; STD; INV; 312 BP. XX AC MH726210; XX DT 17-APR-2019 (Rel. 140, Created) DT 17-APR-2019 (Rel. 140, Last updated, Version 1) XX DE Pheidole sexspinosa isolate ZB17401 cytochrome oxidase subunit 1 (COI) DE gene, partial cds; mitochondrial. XX KW . XX OS Pheidole sexspinosa OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Hymenoptera; Apocrita; Aculeata; Formicoidea; OC Formicidae; Myrmicinae; Pheidole. OG Mitochondrion XX RN [1] RP 1-312 RA Wang W.Y., Yamada A., Eguchi K.; RT "First discovery of Pheidole sexspinosa Mayr, 1870 (Formicidae: Myrmicinae) RT from the Oriental region with redescriptions of the worker, queen and male RT castes"; RL Unpublished. XX RN [2] RP 1-312 RA Wang W.Y., Yamada A., Eguchi K.; RT ; RL Submitted (07-AUG-2018) to the INSDC. RL Lee Kong Chian Natural History Museum, National University of Singapore, 2 RL Conservatory Drive, Singapore 117377, Singapore XX DR MD5; fd36ffe36e9c19306f5ed06a1160d97a. XX CC ##Assembly-Data-START## CC Assembly Method :: PEAR v. 0.9.6 CC Sequencing Technology :: Sanger dideoxy sequencing; Illumina CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1..312 FT /organism="Pheidole sexspinosa" FT /organelle="mitochondrion" FT /isolate="ZB17401" FT /mol_type="genomic DNA" FT /db_xref="taxon:458983" FT gene <1..>312 FT /gene="COI" FT CDS <1..>312 FT /codon_start=1 FT /transl_table=5 FT /gene="COI" FT /product="cytochrome oxidase subunit 1" FT /db_xref="GOA:A0A4P1LX00" FT /db_xref="InterPro:IPR000883" FT /db_xref="InterPro:IPR023616" FT /db_xref="InterPro:IPR036927" FT /db_xref="UniProtKB/TrEMBL:A0A4P1LX00" FT /protein_id="QBX89118.1" FT /translation="LASNIFHSGASIDLSIFSLHIAGMSSILGAINFISTIINMHHKNF FT TMDKIPLLVWSIMITAILLLLSLPVLAGAITMLLTDRNLNTSFFDPSGGGDPILYQHLF FT " XX SQ Sequence 312 BP; 90 A; 62 C; 31 G; 129 T; 0 other; ttagcttcta atatttttca cagaggagct tcaattgacc tatctatttt ttctcttcat 60 attgcaggaa tatcttctat tttaggagca atcaatttta tctctacaat tattaatata 120 catcataaaa attttactat agataaaatc ccactattag tatgatctat tataattact 180 gcaattttac ttcttctttc tctcccagtt cttgctggag ctattactat acttttaact 240 gatcgaaatt taaacacttc tttttttgac ccatctggag gaggtgaccc catcctctac 300 caacatttat tt 312 //