ID MH139344; SV 1; linear; genomic DNA; STD; INV; 432 BP. XX AC MH139344; XX DT 12-JUN-2018 (Rel. 137, Created) DT 13-NOV-2018 (Rel. 138, Last updated, Version 2) XX DE Microgastrinae sp. Extraction748 wingless (Wnt1) gene, partial cds. XX KW . XX OS Microgastrinae sp. Extraction748 OC Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; OC Neoptera; Holometabola; Hymenoptera; Apocrita; Parasitoida; Ichneumonoidea; OC Braconidae; Microgastrinae; unclassified Microgastrinae. XX RN [1] RC Publication Status: Available-Online prior to print RP 1-432 RX PUBMED; 29791787. RA Fagan-Jeffries E.P., Cooper S.J., Bertozzi T., Bradford T.M., Austin A.D.; RT "DNA barcoding of microgastrine parasitoid wasps (Hymenoptera: Braconidae) RT using high-throughput methods more than doubles the number of species known RT for Australia"; RL Mol Ecol Resour 0:0(2018). XX RN [2] RP 1-432 RA Fagan-Jeffries E.P., Cooper S.J.B., Bertozzi T., Bradford T.M., RA Austin A.D.; RT ; RL Submitted (29-MAR-2018) to the INSDC. RL Ecology and Evolutionary Biology, The University of Adelaide, School of RL Biological Sciences, The University of Adelaide, Adelaide, South Australia RL 5005, Australia XX DR MD5; 75243ad1c8bcfcb423bf85ed7cd72d87. XX FH Key Location/Qualifiers FH FT source 1..432 FT /organism="Microgastrinae sp. Extraction748" FT /mol_type="genomic DNA" FT /country="Australia:South Australia, In or nr. Mamungari FT Conservation Park" FT /lat_lon="29.11 S 129.54 E" FT /specimen_voucher="Extraction748" FT /collected_by="E. Fagan-Jeffries" FT /collection_date="23-Sep-2017" FT /db_xref="taxon:2212278" FT gene <1..>432 FT /gene="Wnt1" FT mRNA <1..>432 FT /gene="Wnt1" FT /product="wingless" FT CDS <1..>432 FT /codon_start=1 FT /gene="Wnt1" FT /product="wingless" FT /db_xref="GOA:A0A2U9DQB5" FT /db_xref="InterPro:IPR005817" FT /db_xref="UniProtKB/TrEMBL:A0A2U9DQB5" FT /protein_id="AWP39799.1" FT /translation="SCTVKTCWMRLPLFKIVGDNLKDRFDGASRVMISNSDRIRGSGNA FT IVSNSASNFVHGPRQGLGRRQRYSFQLKPYNPEHKPPGLKDLVYLEPSPPFCDKNPKLG FT ILGTQGRQCNDTSIGVDGCDLMCCGRGYKTQEVIVVERCA" XX SQ Sequence 432 BP; 131 A; 75 C; 99 G; 127 T; 0 other; tcgtgtacag ttaaaacctg ttggatgcgt cttccattat ttaaaatagt tggtgacaat 60 ttgaaagatc gctttgatgg tgcatctcga gtcatgatta gtaattcaga ccggattcgt 120 ggttcaggaa atgctattgt tagcaattct gccagtaatt ttgttcatgg tcctcgtcag 180 ggccttggac gccgacaacg ctacagtttt caacttaaac catataatcc agagcacaaa 240 ccaccaggat tgaaagattt agtctattta gaaccatcac caccattttg tgataaaaat 300 cctaagcttg gaatattggg tacccaaggt agacaatgta atgatacaag tattggagta 360 gacggatgtg atttgatgtg ttgcgggaga ggctacaaaa cccaggaagt aatagtagtt 420 gaaagatgtg cg 432 //